The latest SPPS application data
-innovative solution for peptide chemistry-
Biotage Japan Ltd.
Biotage
Microwave-Assisted Organic Synthesis (MAOS) Rapid Solvent Evaporation Automated Flash PurificationWith more than 5,000 discovery chemistry systems installed in over 600 facilities worldwide, Biotage automated systems and consumables work together to increase productivity and improve success rates
Solid-Phase Extraction (SPE)
Synthesis Work-up Purification Evaporation
Outline
• Microwave heating
• Application of Peptide Synthesis
-Difficult sequence
-
N
-Methylated amino acids
-Selenocysteine
-Glycosylated amino acids
-ChemMatrix
• System
-Peptide Synthesizer
-Comparison: Synthesis method
• Faster and more precise heating
• Faster chemical reactions
• Greater yields and better purities
• Novel reactions
• The rate of heating is generally higher than by
conventional means
• No temperature gradient through the sample
• The energy transfer is direct to the absorbing
reactants
• Allows reactions to occur in a more controlled
manner in a decreased time scal
Microwave Assisted Peptide Synthesis
Using Biotage Instruments
Manual SPPS
M. Erdélyi, A. Gogoll, Rapid microwave-assisted solid phase peptide synthesis, Synthesis, 2002, 11, 1592-1596*
M. Brandt, S. Gammeltoft, K. J. Jensen, Microwave heating for
solidphase peptide synthesis: General evaluation and applications to 15-mer phosphopeptides, International Journal of Peptide Research and Therapeutics, 2006, 12(4), 349-357
Semi-automated SPPS
S. L. Pedersen, K. K. Sørensen, K. J. Jensen, Semi-automated
microwave-assisted SPPS: Optimization of protocols and synthesis of difficult sequences, Biopolymers (Peptide Science), 2010, 94, 206-212
Fully automated SPPS
L. Malik, A. P. Tofteng, S. L. Pedersen, K. K. Sørensen and K. J. Jensen, Automated „X-Y‟ robot for peptide synthesis with microwave heating: Application to difficult peptide sequences and protein domains, Journal of Peptide Science, 2010, 16, 506-512
What is a difficult sequence
So called “difficult sequences” are problematic if not
impossible to synthesize using standard coupling and
deprotection protocols
Difficulties are mainly related to:
•
Intra- and/or intermolecular aggregation
•
Secondary structure formation
•
Steric hindrance of protecting groups which can
Pancreatic Peptide YY3-36 (1-40)
analogue
The peptide hormone PYY3-36 plays a central role in the regulation of food intake and energy homeostasis.
Synthesis is difficult due to reported PYY3-36 analogue consisting helix and loop due to C-terminus.
PYY3-36 analogue peptide reagent
• Resin: Fmoc-TG Rink amide resin 0.24 mmol/g loading
• Amino Acids: 770-μL of 0.5M Fmoc-AA in NMP with HOBt and HOAt (9:1)
• Coupling: + 880 μL of HBTU/NMP (0.43 M) + 380 μL of DIPEA/NMP (2.0 M)
• De-protect: 2000 μL of 40% piperidine in DMF • Wash: NMP
PYY3-36 analogue method
• Synthesis Scale: 100 mmol
• Deprotection: 3 min with 40% piperidine in DMF at RT +10 min with 20% piperidine in DMF at RT • Wash: 3 x 45 sec with NMP at RT
• Coupling: 1 x 45 min for RT
or 1 x 10 min @ 75 0C (microwave) • Wash: 3 x 30 sec with NMP at RT
3 x 30 sec with DCM at RT
Synthesis of PYY3-36 analogue
H-YLERELKKLERELKKLSPEELNRYYASLRHYLNLVTRQRY-NH2 Crude Purity 23% Crude Purity 35% 45 min at RT 10 min at 75ºC assisted MW Product ProductWhy are we interested in
N
-Methylated
amino acids
R
• Exist in many biologically-active natural products
• Help obtain information about backbone conformation
• Offer improved lipophilicity, proteolytic stability and
bioavailability
• Replacement of natural amino acid for
N
-methyl
amino acid in biologically active peptides has resulted
in analogue with improved pharmacological properties
Coupling onto
N
-Methylated amino acids
• The experiment was to synthesize four different N-methylated peptide sequences.
• Sequences were MeZGYGGFL, with Z being Ala, Ile, Phe or Val,
these to be some of the most difficult N-methylated amino acids to couple onto.
Z Z
Coupling onto
N
-Methylated amino acids
Coupling onto MeAGYGGFL
Coupling onto MeFGYGGFL
Coupling onto MeIGYGGFL Coupling onto MeVGYGGFL
Coupling condition Coupling condition
Synthesis of
N
-Methylated Peptide
Improved coupling conditions for coupling Fmoc-Ala-OH onto MeIGYGGGFL peptidyl.
N
-Methylated Trimer Synthesis
H-
MeAla-
MeIle-
MeGly-NH
2 Coupling condition for the synthesis of peptideH-
MeAla-
MeIle-
MeGly-NH
2 24 h at RT 1.00 2.50 3.75 5.00 6.25 7.50 8.75 10.00 -50 100 200 300 UV_VIS_1 mAU min WVL:215 nm 1.00 2.50 3.75 5.00 6.25 7.50 8.75 10.00 -200 0 200 500 UV_VIS_1 mAU min WVL:215 nm 2 x 10 min at 75ºC assisted MWOverall synthesis time: ~74 h
Overall synthesis time: ~3 h
Product Product Crude Purity 39% Crude Purity 80%
What is a Selenocysteine
• The 21st amino acid incorporated in proteins by
the genetic codon.
• The active center of redox selenoenzymes, such
as glutathione peroxidase.
• The application to determination of protein
structure.
HO
2C
SeH
NH
2Synthesis of Selenopeptide
H-Gly-Gln-Ala-Sec-Ala-Trp-Gly-NH
2Coupling condition for the synthesis of selenopeptide
Synthesis of Selenopeptide
H-Gly-Gln-Ala-Sec-Ala-Trp-Gly-NH
2Overall synthesis time: ~10 h
Overall synthesis time: ~5 h Crude Purity 22% Crude Purity 48% 40 min at RT 5 min at 75ºC assisted MW Product Product UV 220 nm UV 220 nm
Glycosylated amino acids
H-TRPAPGST*APPAHGVT*SAPD-NH
2• The 20-mer MUC1 tandem repeat sequence is a large
extracellular glycoprotein which exist ubiquitously on the surface of mammalian cell membranes.
• Glycosylated amino acids use mono-saccharide derivatives of Fmoc-Thr(Ac4-β-Glc)-OH and Fmoc-Thr(Ac3
Synthesis of Glycopeptide
H-TRPAPGST*APPAHGVT*SAPD-NH
2T* = Thr(Ac4-β-Glc) or Thr(Ac3-α-GalNAc)
Glucose Peptide
Synthesis of GlycoPeptide
H-TRPAPGST*APPAHGVT*SAPD-NH
2HPLC chromatograms for the synthesis of the 20 mer peptide 1
using different reaction conditions
20 min at 75℃ assisted MW 20 min at RT 2 h at RT 20 min at 75℃ assisted MW +depro 2 min at 60℃ Crude Purity 53% Crude Purity 33% Crude Purity 38% Crude Purity 15%
Synthesis of GlycoPeptide
H-TRPAPGST*APPAHGVT*SAPD-NH
220 min at 75℃ assisted MW Crude Purity
64% Entry 6 Entry 5 Crude Purity 30% 20 min at 75℃ assisted MW +depro 2 min at 60℃
HPLC chromatograms for the synthesis of the 20 mer peptide 2
ChemMatrix Resins
• Biotage is now distributing ChemMatrix resins
• Biotage have selected 5 of the most popular linker chemistries for SPPS (Rink, Wang, HMPB, Trityl, PAL)
• ChemMatrix is a patented 100% PEG resin from Matrix
Innovation that offers substantial advantages over traditional PS & PEG based resins for SPPS
• Peptides produced with ChemMatrix - higher purity and yields
•
Exceptional stability
– more stability for the
chemistry needed in peptide synthesis
•
No Leaching
– does not add impurity to the end-users
work flow
•
Excellent solvent compatibility
– organic or
aqueous, water or otherwise
•
Many choices of linker and also pre-loaded
options available
– we have access to a wide choice
•
Proven superior performance
– comparison of
synthesis of Selenoglutathione using Rinak
amide-ChemMatrix and PS resin shows significant advantages
•
Microwave compatible
– in peptide synthesizers or
manual synthesis
Case Study: Selenoglutathione
g
-Glu-Sec-Gly
Se
Case Study: Selenoglutathione
g
-Glu-Sec-Gly
Overall synthesis time: ~5 h
Overall synthesis time: ~5 h Crude Purity
34%
Crude Purity 77%
MBHA Rink amide resin at RT
ChemMatrix Rink amide resin at RT
Product
Product
UV 220 nm
Synthesis of C-terminus of MuLV CTL epitope
H-WFTTLISTIM-NH
2Synthesis of Dendrimer Peptide
Different reaction conditions for the synthesis of dendrimer like structure
ChemMatrix Resins
Product Product Product Product Product Fmoc-S-RAM-TG 45 min, RT Fmoc-S-RAM-TG 2 x 120 min, RT Fmoc-S-RAM-TG 5 min, 75℃ Fmoc-S-RAM-TG 2 x 10 min, 75℃ ChemMatrix 5 min, 75℃Peptide Synthesizer from Biotage
Syrowave (Auto) Syro I (Auto) Syro II (Auto)
Initiator Peptide Workstation
(Manual) Initiator
+ SP wave
Syro I:Full-Automatic
Single robotic arm
2 x digital syringe pump 1 Vortex mixers: parallel Choice of either:
24 or 48 channel reactor Vacuum Pump
Amino Acid Rack:
32 x 50 ml Falcon Tubes Reagent Bottle Rack:
2 x 500 ml , 3 x 200 ml Waste Bottle: 1 x 10 liter
Synthesis on 1-300 µmol scale Includes Dell Desktop PC
Flat Panel Monitor, Printer Syro XP Software
Initiator+ Peptide Workstation: Manual
• Microwave assisted peptide • Manual synthesis
• Disposable 2-5 and 10-20 ml glass reactor vials with HDPE frits
Initiator
+SP wave: Semi-Automatic
• Microwave assisted peptide and organic synthesis
• Semi-automated
• Disposable 2, 5 and 10 ml PP-reactor vials with PTFE frits
• Synthesis on 5-300 µmol scale • Inert gas capability
• Easy-to use Initiator 4.0 software • Use pre-defined templates or
define your own • Vortex mixing
• Single robot arm, digital syringe pump
Syrowave: Full-Automatic
Microwave cavity Single robotic arm
1 x digital syringe pump
2 Vortex mixers: Microwave & parallel
Choice of either:
24 or 48 channel reactor Vacuum Pump
Amino Acid Rack:
32 x 50 ml Falcon Tubes Reagent Bottle Rack:
2 x 500 ml , 3 x 200 ml Waste Bottle: 1 x 10 liter
Synthesis on 5-300 µmol scale Includes Dell Desktop PC
Flat Panel Monitor, Printer Syro XP Software
Comparison: Synthesis method
1. ACP65-74: H-VQAAIDYING-NH
22. LysM: H-LPERVKVVFPL-NH
23. JR: H-WFTTLISTIM-NH
2• Synthesis of a difficult peptide sequences using different levels of automation for microwave assisted SPPS: manual,
semi-automated and fully semi-automated systems.
• Three different peptides synthesized as test sequences. All the peptides were synthesized on the PEG-based ChemMatrix
Compare to the system
ACP 65-74: H-VQAAIDYING-NH
2 Crude Purity 97% Product Crude Purity 93% Crude Purity 94% ProductProduct 2 min at 75℃ assisted MW
2 min at 75℃ assisted MW 2 min at 75℃ assisted MW 1 Syro Wave (Full-Auto) Initiator Peptide Workstation (Manual) 2 Initiator+, SP Wave (Semi-Auto) 3
Compare the peptide synthesizer
1. ACP 65-74: H-VQAAIDYING-NH
22. LysM: H-LPERVKVVFPL-NH
23. JR: H-WFTTLISTIM-NH
2Summmary
• Reduction in synthesis time and an increase in purity using Microwave Irradiation in SPPS
-PYY 3-36 of Difficult Sequence -N-Methylated Peptide
-Selenopeptide -Glycopeptide
• Improve the purity using ChemMatrix
-MuLV CTL epitope peptide in Difficult Sequence -Selenoglutathione
-Dendoric structure peptide
• Compare to the instruments for microwave assisted SPPS.
-The Initiator Peptide Workstation gave the fastest cycle times however, is the most labor intensive.
-The Syro Wave system gave excellent purity peptides with the least amount of user input.
-The semi-automated Initiator+ SP Wave system required the perfect
setup in terms of speed of synthesis, quality of peptides produced and level of user intervention.
Conclusion
• Microwave is powerful technique for accelerating the synthesis of peptides and peptidomimetics.
• Reduction in synthesis time and an increase in purity.
• Improve coupling rates and prevent side reactions in SPPS.
• ChemMatrix is efficient resin for Microwave in SPPS.
• Three instruments of automation solutions for microwave assisted SPPS provided peptides with high level of purities but differ in cycle times and level of user intervention