[PDF] Top 20 A Mutant Tat Protein Inhibits HIV-1 Reverse Transcription by Targeting the Reverse Transcription Complex
Has 10000 "A Mutant Tat Protein Inhibits HIV-1 Reverse Transcription by Targeting the Reverse Transcription Complex" found on our website. Below are the top 20 most common "A Mutant Tat Protein Inhibits HIV-1 Reverse Transcription by Targeting the Reverse Transcription Complex".
A Mutant Tat Protein Inhibits HIV-1 Reverse Transcription by Targeting the Reverse Transcription Complex
... a mutant of Tat referred to as Nullbasic inhibits HIV-1 reverse transcription although the mecha- nism of action is ...a reverse transcriptase (RT) binding ... See full document
10
Shutdown of HIV 1 Transcription in T Cells by Nullbasic, a Mutant Tat Protein
... ZSG1-treated, HIV-1-infected Jurkat cells were pelleted and washed once with 1 ⫻ PBS ...of 1 ⫻ PBS buffer and cross-linked with 1% form- aldehyde for 10 min at room ...with 1 ⫻ ... See full document
11
Human Immunodeficiency Virus Type 1 Integrase Protein Promotes Reverse Transcription through Specific Interactions with the Nucleoprotein Reverse Transcription Complex
... IN protein from that of the Gag-Pol precursor protein and suggested that it was possible to directly analyze IN protein function by introducing mutations into IN without interfering with Gag-Pol ... See full document
10
Primer tRNAs for reverse transcription.
... in HIV-1 and HFV, respectively, and do they perform similar functions? What is the role of genomic RNA in primer tRNA packaging in Ty1, for which mutations in the packaged RNA seem to affect primer tRNA ... See full document
9
PF74 Reinforces the HIV-1 Capsid To Impair Reverse Transcription-Induced Uncoating
... isolated HIV-1 cores by measuring their ...CA protein in vitro and to purified HIV-1 cores increased the stiffness of the capsid in a concentration-dependent ...capsid inhibits ... See full document
11
Uracil DNA glycosylase interacts with the p32 subunit of the replication protein A complex to modulate HIV 1 reverse transcription for optimal virus dissemination
... Finally, replication of viruses produced from cells depleted of both endogenous UNG2 and RPA32 pro- teins was evaluated in MDMs. 293T cells were thus co- transduced with two lentiviral vectors expressing specific shRNAs ... See full document
20
Dephosphorylation of CDK9 by protein phosphatase 2A and protein phosphatase 1 in Tat activated HIV 1 transcription
... holoenzyme complex which can be activated by phosphorylation of NIPP1 ...that protein phosphatase-1 (PP1) is a posi- tive regulator of HIV-1 transcription in vitro [25] and in ... See full document
15
The Tat Protein of Human Immunodeficiency Virus Type 1 (HIV-1) Can Promote Placement of tRNA Primer onto Viral RNA and Suppress Later DNA Polymerization in HIV-1 Reverse Transcription
... type-1 Tat has been proposed to play a role in the regulation of reverse ...wild-type Tat can augment viral infectivity by suppressing the reverse transcriptase (RT) reaction at late ... See full document
9
HIV 1 Uncoating and Reverse Transcription Require eEF1A Binding to Surface Exposed Acidic Residues of the Reverse Transcriptase Thumb Domain
... diverse HIV-1 ...of protein-protein interactions (34, ...the HIV-1 thumb domain is not part of the polymerase active site or the floor of the DNA binding cleft, where only the ... See full document
20
Human Immunodeficiency Virus Type 1 Protease Regulation of Tat Activity Is Essential for Efficient Reverse Transcription and Replication
... type 1 (HIV-1) Tat protein enhances reverse transcription, but it is not known whether Tat acts directly on the reverse transcription complex ... See full document
10
Human immunodeficiency virus -1 (HIV-1) –Transactivator of transcription protein (Tat) effects on Macrophage polarization
... of HIV-1 Tat on the immune cells: CD4 + T cells and macrophages Patients infected with HIV and left untreated undergo characteristic disease stages as their condition ...virus complex ... See full document
86
Isolated HIV 1 core is active for reverse transcription
... purified HIV-1 virion cores are capable of reverse transcription or require uncoating to be activated is currently ...authentic reverse transcription ... See full document
5
Blocking premature reverse transcription fails to rescue the HIV 1 nucleocapsid mutant replication defect
... endogenous reverse transcription activity from wild-type virus pre- pared in the absence or the presence of RTIs, respec- ...endogenous reverse transcription ...measured reverse ... See full document
14
Reverse Transcription Mechanically Initiates HIV-1 Capsid Disassembly
... The HIV-1 core consists of the viral genomic RNA and several viral pro- teins encased within a conical ...Although HIV-1 uncoating has been linked to reverse transcription of the ... See full document
14
Host SAMHD1 protein restricts endogenous reverse transcription of HIV 1 in nondividing macrophages
... the reverse transcription steps that is rate limiting in this nondividing cell type due to the SAMHD1-mediated dNTP ...that HIV-2 produced from macrophages should have higher ERT activity than ... See full document
11
Reverse Transcription System
... Transcription System can be used directly in PCR. Reverse Transcription System All technical literature is available on the Internet at: www.promega.com/protocols/ Please visit the web site to verify ... See full document
8
Interaction between Reverse Transcriptase and Integrase Is Required for Reverse Transcription during HIV-1 Replication
... Replication-defective and poor-RT-binding IN mutants are impaired in early viral cDNA synthesis. Our analyses thus far have indicated that several amino acid substitutions on the pur- ported RT-binding surface of IN ... See full document
12
The RNA binding protein HuR does not interact directly with HIV 1 reverse transcriptase and does not affect reverse transcription in vitro
... fusion protein is not stable in solution for extended periods and is subject to degradation, casting doubt on the validity of the above ...between HIV-1 RT and a degraded/unfolded form of ... See full document
7
Phosphorylation of HIV 1 Tat by CDK2 in HIV 1 transcription
... of Tat (MEPVDPNLEPWKHPGSQPRTACNNCYCKKCCFHCYA CFTRKGLGISYGRKKRRQRRRAPQDSQTHQASLSKQ) as ...to Tat were further compared with Tat peptides from which we subtracted 18 Da, assuming β -elimination of ... See full document
21
HIV 1 associated PKA acts as a cofactor for genome reverse transcription
... for HIV-1 genome reverse transcription Life cycle of ...prepared 1 hour after viral exposure to avoid sample contamination with de novo synthesized viral mRNAs and infections were ... See full document
13
Related subjects