• No results found

Into the park

N/A
N/A
Protected

Academic year: 2019

Share "Into the park"

Copied!
60
0
0

Loading.... (view fulltext now)

Full text

(1)

Rochester Institute of Technology

RIT Scholar Works

Theses

Thesis/Dissertation Collections

2004

Into the park

Joel Lederer

Follow this and additional works at:

http://scholarworks.rit.edu/theses

This Thesis is brought to you for free and open access by the Thesis/Dissertation Collections at RIT Scholar Works. It has been accepted for inclusion in Theses by an authorized administrator of RIT Scholar Works. For more information, please [email protected].

Recommended Citation

(2)

Into the Park

Submitted in partial consideration of a Master of Fine Arts Degree in Photography

Joel Lederer

Rochester Institute of Technology

Rochester, NY 2004

Jeff

weiss _ _

J_·

W_e_i_ss _ _ _ _

'f_,_!

B~,

_o_7

__

_

Willie osterman _ _

W_._O_s_t_e_r_m_a_n ___

0-

_.

/

....:.~_

.

_

.L!.

_

/

_ _

Elliott Rubenstein

s

/

f

/

/

o

f

}

7

(3)

Thesis/Dissertation Author Permission Statement

Title of thesis or dissertation: _ _ _ ..l-_rl_';O _ _

---.:.~--=-:~E.~_\?.:..._.:I}~Q..._K-~

_ _ _ _ _ _ _ _ _

Name

~f

author:

-:-~~7'r'--_

2>

t.""'-

>

~L.=--_....:::l:::....t.=

·

-~\j~~:::.\2..!._.::Jc;.=__~~

_ _ _ _ _ _ _ _ _ _ _ _

_

Degree.

tI\

F

tE

Program: tv)

F

A- _

\J

I."cl:J1 «,(l:=

College:

C.

r

as

-

'Vc)c'vo~!/2-

r NSI' [....)1"< ,./-

r

o c:..\"'NcJlo

S1

I understand that I must submit a print copy of my thesis or dissertation to the RIT Archives, per current RIT guidelines for the completion of my degree. I hereby grant to the Rochester Institute of Technology and its agents the non-exclusive license to archive and make accessible my thesis or dissertation in whole or in part in all forms of media in perpetuity. I retain all other ownership rights to the copyright of the thesis or dissertation. I also retain the right to use in future works (such as articles or books) all or part of this thesis or dissertation.

Print Reproduction Permission Granted:

J,

.3'

,-,

£L

Leo£~eiL

,hereby grant permission to the Rochester Institute Technology to reproduce my print thesis or dissertation in whole or in part. Any reproduction will not be for commercial use or profit.

Signature of Author: _ _ _

J_o_e_I_L_e_d_e_r_e_r ___

Date:

/VI) \

&

-

2-0

0

4

Print Reproduction Permission Denied:

J, , hereby deny permission to the RIT Library of the Rochester Institute of Technology to reproduce my print thesis or dissertation in whole or in part.

Signature of Author: _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ Date: _ _ _ _ _ _

Inclusion in the RIT Digital Media Library Electronic Thesis

&

Dissertation

(ETD

)

rlrChlVe

I, ' additionally grant to the Rochester Institute of Technology Digital Media Library (RIT DML) the non-exclusive license to archive and provide electronic access to my thesis or dissertation in whole or in part in all forms of media in perpetuity.

I understand that my work, in addition to its bibliographic record and abstract, will be available to the world-wide community of scholars and researchers through the RIT DML. I retain all other ownership rights to the copyright of the thesis or dissertation. J also retain the right to use in future works (such as articles or books) all or part of this thesis or dissertation. I am aware that the Rochester Institute of Technology does not require registration of copyright for ETDs.

I hereby certify that, if appropriate, I have obtained and attached written permission statements from the owners of each third party copyrighted matter to be included in my thesis or dissertation. I certify that the version I submitted is the same as that approved by my committee.

(4)

Introduction

Mythesis exhibition, "DowntheStreetandIntothePark," wastheculminationof

several yearsI spentexploringthe subject oflandscapeandmakingimageswandering

andgetting lost in ideas andinpictures. Althoughthiswork exploresthe subject of

nature,makingtheimageswas perhaps theonly "natural"thingaboutthe work.Though

thereweretherequisiteleaves, rocks anddirt,I eventually realizedthatnothing I

photographedwas really

"natural,"

but simplypropsfor my imagery.

Theexhibition dealtwiththeorganiclandscape fromtheperspective of one who had

neverreally leftthecity.Thework presents visual ideasof whatthe landscapemeantto

me and,hopefully,to others. Inthis paper, Iexplain theprocess ofmakingthework: the

ideasand referencesthatI cultivated whileworking,andmyvisual methods and

metaphors. I hopethatit gives someinsight intonotonly whatIwasthinkingaboutbut

alsohowthework progressed.

Growingup inan urban environment coloredmyview ofthelandscape. Cities, with

their neighborhoods, beachesand lakesweretome objects withtheirownindividuality

and character.Outofthe citywerethefarmer's market,summercamp, Santa'sVillage,

national parks,andtheme parks,whichdeveloped formethis notion oftheplace as an

object.Only

"nature"

asthe generic we callit,was a greener and lesspopulated object

than thecity orthe beach. Naturewas a placetowhich youhadto drive,a place where

themonotonyoftreesandsky was overshadowedbymosquitoes and thelackof urban

amenities.

Myearly education at aZionist grammar schoolinChicago, withits discussions

about a promised land(Israel) thatneeded mefor itsredemption, transformed the ideaof

theland-as-objectintotheland-as-idea. Inschool, Iwould watch movies aboutIsrael,

wherethepeople lookedlikemebut actedanddressed differently. Theyweredepicted

wearinggymclothes,pickingorangesfrom trees, carryingweapons and the

cinematography represented themwithinthis specific environment.

As goodZionistschoolchildren,we weretaughtabouttheimportanceofthisland.

Givingit assistance was a serious missiontobeembraced with pride. Ouractivities

included collecting money fortree planting,andI would propositionmy

parents' friends

forthis worthycause.Although I couldn'tquitegrasp atthatageitsimportance,I knew it

was amandatoryandsomehow beneficialcause.Now theideaoftheland-as-object was

expandedintothatof an objectthatwasdesigned andfundedby good people. Like any

(5)

"-VSf> :.,

.-.--: -5V --^--:

- -r"

..-I:

'

-.

;;^^>_ >^

. - -.;- --:--v":-.>i-v< r igsMB

"

IBBfc

}

(6)

constructioneffort was under way. Ironically,I discoveredyearslaterthat this ideawas

mostly correct.

Due tothese activities, naturehadcometorepresentsomethingthatone "did"

either

forrelaxation,asinvacation spots(Miami was also natureto meheatandhumidity,

and alargeexpansivesky providedtheatmosphere), shopping for betterproduce(the

farmer'smarketoutside ofChicago hadexcellentblueberries), ortolearnaboutthepast

(AmishAcresprovided ahistorical setting foractorsto dress up inperiod costumes and

re-enact scenesfromthepast).Aswell, my ideasof naturehad becomesynonymous with

arefuge; and onethatneeded usfor its defense.

Withtheseideasfermentingthroughout adolescence,I decided tomovetoIsraelat

theage of22 (after receiving myundergraduatedegree in New York City). I had, over

those years, learnedmore aboutIsraelandthelanguage ofitspeople. While Iunderstood

thatitwas similartoother placesin the world,I stillhad theidea thatIsraelwasthe

paradigm of

"nature,"

andthatbymovingthere Iwouldbecome more"natural".

I had mostly feltthatIsraelwouldbea good placeformeto developmyphotography,

away fromthefamiliarcities ofAmerica andina contextthatheld differentaesthetic

possibilities and problems.As aresult, most ofthephotographs Imade duringmy seven

yearstherecenter aroundtherelationshipofthenatural to theman-made.Thisis because

theurban areastherewerebuilt-upquickly and without much aesthetic consideration.

Theaccidentallookofthe streets andbuildingsofTel-Avivseemedtomimic aforestor

jungle whosedesignwas pragmatic and unconcerned withitsaesthetic appearance.

Unlike New YorkCityorChicago I feltasthoughIwasphotographinguntamed nature.

I could makesomething outofthis material,something otherthana mere representation

oftheobjectthatitwas.

The"natural" areas ofIsrael ontheotherhand,withtheir trees that I had helpedfund,

seemeddesignedand manicured. Theywereessentially, andliterally,parks.Thus, the

natural seemedman-made, andthe artificial seemed natural. Itthenbecame my task to

exploreand recordthe lookofthingsfromwithinthisframeof reference. In hindsight,

this startingpointwasinspired bymyownjourneyforself-understanding. My

"quest"

had beenalwaystofinda sense ofharmony between my environmentand myself. What I

had labeled"man-made" and

"natural"

essentiallymeant "me"

and"the

Universe."

My techniquewasinspiredbyreadings onTaoism andZenBuddhism. Ifeltthat the

way tomakephotographswasto deconstructtheconcepts and visionthatIhad been

taught, and attempt tobecomeunified withinmy surroundings. I feltthatif I could

(7)

-Ty

(8)

harmonywithmy environmentandultimatelywithinmyown mind. Iwasinspiredinthis

questbythe words oftheTao Te Ching:

Attainthe climaxofemptiness,

Preservethe utmost quiet:

Asmyriadthingsactinconcert,

Itherebyobservethereturn.

Thingsflourish,

Theneach returnstoitsroot.

Returning to therootiscalledstillness:

Stillness iscalled returntoLife,

Returnto life iscalledthe constant;

Knowingthe constantiscalled

(9)
(10)

Pre-Thesis Work

After arriving attheRochester InstituteofTechnologyforgraduate studiesin

PhotographyI continuedtoexplorea project I had begun in Israel: anexplorationofthe

twomostelemental organicsubjects, skies and sea. The images from my firstquarter's

review were small black-and-whiteimages oflandscapeelements,pairedincoupletsto

givean expressionofhuman interaction. The objectsthatI photographedwere meantto

representlarger opposing actionsalways at work: comingtogetherandsplittingapart,

entering andexiting, coveringandrevealing.This seemedtomethenatural progression

ofmywork: therhythmand essence ofthelandscape. Ineededtocontinue withthat

ritual ofmakingimages,thoughmyclassmates and professorsfelt differently.

Inthatfirstcritique,my finalproduct appeared toreviewersto betoofamiliar,too

straight-edgedand nostalgic. Landscape,Iwastold, was a"dead" subject thatheld little

interest forthecontemporaryartscene,whose concerns weredifferentand more specific.

Thecritique directedmeto a place whereIwasn'tcomfortable, where myabilities would

beputto the test.Yes,thefinalresults weretooderivative, yetI couldn't agreethat the

subject oflandscapewas trivial.Theappearance ofthelandand ourinteraction withitare

subjects worthyof aesthetic contemplation as well asbeingofhistorical importance.

There was one picturefromthefirstquarter's portfoliothatledmeto shiftmy

approachto thissubject.While photographing atthelakeoneday,Ihad become

frustratedthinkingabouteverythingthatwaswrongwithmy subject matterand,forthat

matter, my photographyoverall. Outofthisfrustration I beganthrowingrocksintothe

water, andto mysurpriseIthenbeganto see picturesintheconcentric ringsthatwere

made onthesurface ofthe still water,and made severalimages. In thefollowingweek's

critique,my classmateBrianEmerycommentedthat these images illustrated how forthe

firsttimeI had interactedwithmy subjectina physical way. Itwas an epiphanic moment

forme,whichledmeto realizethat thenext step in my photographicdevelopmentwasto

incorporatethemark ofmy ownhand intotheimagery.

My second quarter work revolvedheavilyaroundthisidea, and was a combination of

thephotographsI had beentakingandthe sketching I woulddo formyself. I had begun

touseAdobePhotoshoptomakeimagesthatmimickedthe process ofhand painting on

photographs,atechniqueI had learned from Jill EnfieldatParsons School ofDesign.

These digital images combined natural elements: branches, iceandshrubbery, withflat

colorfieldswhose purpose wasto hideanddisguisethenaturaland place themwithinthe

(11)

Lk

\

\h

-<N -

(12)

transformingit fromaphotographintoabstracted"painting."Objective formwas

flattened-out,andthe subject washeavilymanipulated.

As Iwas experimentingwiththeprocess ofcombining photographyand

drawingsomeimages appeared as

photographsbut wereinessencedrawn (as inthe

blue-printbranches), and someappearedasdrawings butwerein factphotographs(as in

theice).

ItappearedthatI wasattemptingtousetheseimagesashieroglyphs; theforms they

tookseemedtomimic crude drawingsof animals ortopography. Some looked asthough

painthad been scratched awaytorevealsomething hiddenand otherslookedasthough

theobjectwasbeing obscuredintentionally. The drawingswere primitive andtheir

strokeserratic;theymimickedtheappearance ofdoodles or sketches. I begantorealize

theconnectionbetween sketchinganddraftwriting; bothweretimelessmeans of

recording. I had feltthat something,as yetundefined,wasstarting tohappen.

IntheendI had founda method andtechnique,and perhaps made couple of good

images,yetthemessage seemed unclear.Atthattime, myprofessorElliott Rubenstein

toldmethatmy goal shouldbetofinda reasonfor combiningthismethod withmy

subject, therebycreatinga meansfortheirco-existence.

Ostensibly,mynew process was an experimentthatIafforded myselfinan attemptto

learn some ofthenew technology,and was urgedbymyprofessorstocontinue. Professor

Ostermanencouraged metofindaritual inthisprocessthathopefullywouldleadmeto

an enlightenedview,and subsequently tomore evolved work.Itwashissimple and

timelessadvicethatprovided methecomfort and confidence tocontinueinthese

uncharted waters. Professor Weiss hadasked meifwhatIwasmaking were photographs.

I toldhim thatI really didn'tknow,andhis reply wasthatitmightbe a goodideatofind

out. Though Ihadnoideaas towhathemeant,itsomehow stuck with me.

I was unsure wheretogo next. Ihadamethod, butwas uncertain asto howthat

should manifestitself intheimagery. Iknew thatI wantedto continue withthelandscape

as asubject, and sobegantocreate moreheavilymanufacturedscenerywith more

obvious manipulations.I continuedwiththe"cutout"

style as well asthe"drawing on

technique"

while also beginningtore-form objects themselves.

As Icontinuedtoevolvethis process, Icametounderstand thatwhatI had been

makingwere allegorical representations ofhowwe view thelandscape. Symbolically,it

representedourculturally manufactured method ofhow welookatthe land. The images

werean exploration oftheman-altered environment. Perhaps makingtheseimages from

(13)

r

a

(14)

wasbuilt-up byhuman handsandmachines, our means ofregarding itwasformedby

equally human ideas andmemories,televisionand other cultural media, stories and

heritage. Inotherwords, our visionis coloredbythemessagesthatsurround us. Mostof

all,Iwantedthese ideastobeas accessible astheland.

Itwasimportant formeto show howtheideaoflandscapesboth urban and

ruralhad become depersonalizedandhomogenous. Ourexpectations of what we see

becamewhat we see; theimages replacedthe worlditself. Picturesare sometimesbetter

than reality;they couldgive usthefeelingof experience withoutthe burdenof

experiencing it directly. Withtheseconcepts beginningto takeshapemythesiswork

(15)

"The RootsScroll"

14x188 inches

Inkjeton parchment paper

(16)

The Roots Scroll

The Roots Scroll isperhapsthe mostdirectvisual descendentofmy firstyear's work atRIT. Itcontainedtheaforementionedsubtractive(cut-out) processtodigitallyfuse photographyanddrawingwhilemakinga more overt statement aboutthesubject matter

anditsprecedentsinart.Throughthe process ofmakingthispicture(longhours of

careful"cutting"and"connecting" in AdobePhotoshop), my interests in Zen Buddhism

andTaoism becameevident. Inhindsight,theprocess ofmakingtheimagewas a

metaphorforthefinal image itselftherewas somethingthatIneededtounearthinorder

toadvance myselfto thenextlevel. Theprocess ofdigging awayattherootsI beganto

pairthepictures content withitslanguage; itshowed thepoints I hadwantedto express.

Thiswas quite a realizationforme;notonly infinding a new method ofmakingpictures,

but becausearmed withthisnew technique the correlation of subject and medium would combinetogivethepictures theirsignificance. Itappears now that throughProfessor Osterman'sadviseconcerningtheritual, I hadaddressedProfessor Rubenstein'sconcerns about syntaxconflictingwith subject matter.

Myprior educationin photography hadcentered on questions of subject matter and

itspresentation. Abandoningthis traditional approachdirectedmeto seethatdigital

representation allowed metocreatemy ownconceptuallandscapes. In theRootsScroll, I

placedthetree rootswithin a religious(torahscroll)contextinordertopresentitssubject as carryingspiritual weight.

To manyculturesofantiquity, a tree'sroots representedtheroots of our contact with

theGodhead. Trees have special significancein manyculturesfromtheneareast,

probably dueto theirrelative scarcity.Tree worship had becomecommon practicein whichthe tree was consideredtheabodeofthedeity. Offerings werelaid atthe tree's

baseand on its

branches.2

InAncientEgypt, severaltypes oftreesappearin mythology and art(althoughthehieroglyph signifyingthe treeappears tospecificallyrepresentthe

sycamore).Accordingto the BookoftheDead,twin sycamores stood attheeastern gate

ofheavenfromwhichthesun godRa emergedeach morning.TheGreek Godswere

traditionally bornatthefootof atree,andSiddhartha had gained perfect wisdom while

sittingunderthe bodhitree.

Yet, closestto myown culturalhistoryarethe treesoftheJewishtradition. The Kabalisticnotionbasesthecreationoftheworlduponthe ten sefiroth(aspects ofthe

creator).Thesesefiroth are writtenconcepts suchaslove, judgement, wisdom,will, etc.

They serve asthebackbone (theroots)of allthatismanifest, and areorganized uponthe

"cosmictree:"

the structurethatholds God'saspectsinplace.

(17)
(18)

"/ am the one who planted this tree for all the world to

delight in. With it Ispanned the all, calling it all,for all

depends on it, all emanatesfrom it, all need it, all gaze upon itand awaitit.From heresoulsflyforth in

joy."3

Within theRoots Scroll isahiddenlandscapetheunseen structure ofthenatural

world.JustastheUniversewas constructed upon conceptsinthekabalistic tradition, also

echoedinthe Christianbeliefs4,treeroots representtheconcept of a spherethatbinds us

toour past.Thistransforms theobjectinto a collective place.Words such as

"religious,"

"cultural," "ancestral,"

and"spiritual sect,"

followedbythe word"root(s)"evokeastrong

connotationof a pasttowhich we arehistorically connected. For mygeneration,

however, thisconcepthasalways been precariouslyperched.

Having grownup watching Sesame Streetontelevisioninstilled inus a poly-cultural

sense of respectforallpeoples,histories,and lifestyles. Weweretaught tosee ourselves

asfully autonomousbeings boundtoademocratic philosophy whichleveledall notions

of religion andbelongingto an equalplaying field. Ourculture anditsvariedreligions

were considered secondarytoour status as citizens. Ourreligion wasto becelebrated

with certainholiday ritualsthatweleft buriedaway,hiddenfrom daytodayview.Fora

televisionculturelikeminethisplan seemedtowork well.

Ourculturaliconswerebroughttousinthelanguageoftelevision.They gaveus,

figures such asCookie MonsterandBigBird, alongwiththegenerational motto The

MostImportantPersoninthe World is You. Whilethisphilosophy seems noble and

virtuous,itclashed withtherealitiesoftheAmericancultural landscapeofthe time: war

in Vietnam and economicinflation. Thenostalgic

"revival"

ofthe 1950sgrewfromthe

sense that thepast was abetterplace,where values such asfamilyand organized religion

were more deeply ingrainedintheindividual'spsyche.In 1970GaryMarshall createdthe

televisionshow HappyDays,in responseto this situation.Itfilledtheindividual's need

fora collective identityineffectitreplaced culture withhistory,and historypresented

in30-minutesegments waseasily consumed.Thus,

"Retro"

culturewasbornandthepast

was giventous as a virtual place of refuge.

Althoughretro culture was perhaps a new phenomenoninpopularmedia, thisconcept

wasalready well establishedin thearts. Idealized landscapesoftheBaroqueperiodused

historyand mythologyas subject matter and portrayedtheminArcadian5

surroundings.

Sceneswere stagedin dreamlike and poetic states.Characters were presented with

primitivetraitsandchildlike attitudes,self-engrossedlooksand contented poses. They

loungedaroundinan eternalspringtime offreelove. Thesimilaritiesbetween Arcadia

(19)
(20)

freedom from earthlyperil. Thekey difference lies inthatEdenwas a place tobe

someday regained andarcadia was a placethatwasforever lost. Ineithercase, the

presentheldpromisefordarkness,withthe Eden/Arcadia ideal forescape. Inthevisual arts,idealized landscapes "stage"

a scene whosebackgroundand

lighting suggestan attitude ofdeepnostalgia; alongingfor freedom fromsuffering.

Claude Lorrain'scompositionsare almostformulaic intheiruse ofdarkfoliageor rocks

onthesides oftheimage,leadingthe eyeto theclearlightandairy distance. The view

beingpresentediscleanerandtamerthan natureitself. Human figures inthecomposition

rangefrom smallto miniscule so astoelevate thesignificance ofthesetting from

atmosphereto subject.

Among thepresent-dayexamples ofthisUtopian aesthetic model,Trancemusic hasa

similar motive.Ittoo elevatesthemelody ofthemusic to the status of message and

almost eliminates thelyrics.Taking itscuesfromtheBeatles'returnfrom India inthe

late 1960s,Trancemusic uses eastern and primitive rhythms asits inspirationas was also

theimpetus for hippie fashion. Themembers ofTrancemusic culture adorn themselvesin

child-likeclothes, sometimeswearing pacifiers andcarrying stuffed animals. Itsforum,

theRave,is based ontheHappening motif,where largecongregationscelebrate overfull

moonweekends innatural settingsforoutdoordancing andindulgence in drugs. The

themesofPeace, Love, Unity, andRespect

(PLUR)6

arekeyconcepts toTrancers;

echoingpsychedelicculture whileaddingcontemporarypolitical correctness.

Moststrikingtome aboutthecurrent retro movementis how it is wholly lifted from

another era'scounterculture.The mainstreamingof retro cultureintoday'scommercial

market(showpic of ptcruiser) seemstorepresentastrong desiretoreturn to a simpler

wayoflife. Today'ssense of cultural vaguenessisbeingfedandfattenedbya general

apathyand a sensethat thefuture will notbesuch"Happy

Days."

In anycase, theRootsScroll is both homageto ourquestfor insightand admonition

of ourblindness. I wantedtopresenttherootsas amanuscriptdocument on parchment

papertomarktheresemblance in formto the structure of ancientand untranslatabletexts.

Creating anexample of

"authentica"

(something madeto lookfakeby symbolizingthe

realthing)which alsodrewfromtheZenandTaoistbooks Ihadread.

The jadedcynicismthat keptmefrom acceptingthereligious aspects ofthese

teachingswasenlightening. As I hadexpressed,Zen teachingswere philosophical

frameworks fromwhichI tried topracticetheartofphotography. Zenshowed me a

different wayofmaking sense of what can seemlike anillogical pursuit.Itwas a set of

beliefs,whichprovided acompassionateunderstanding of artmaking,whose purpose

(21)
(22)

thechannelingofideasand craftinto a productdevoidof extraneous information;e.g.,

strippingthe essential rootsfromtheirbackground.

A goal ofZen istofind any essence.In mycaseit isthe essenceofformandidea

alongwith aframeworkto cope withthepanic andlossofdaily life. I see nowthat

althoughthe tenetsofZenarehelpful and sometimesprofound, thesearchforessenceis a

hindrancetofindingit. The questforanideal is actuallyanti-Zen, yetthissame

pilgrimageis considered a virtueby our nostalgiccultureits

goal being thereturntoa

betterpast.Ifeel that this quest, whilecharming, isnihilisticandwhollyunproductive.

Theroots scrollis meanttospeaktoall of usin alanguageweinvented ourselves.

Shuryu Suzukisaid:

"Ifan artist becomes too idealistic, he will commitsuicide, because the gap between his ideal and his actual ability

there is a great gap. Because there is no bridge long

enoughto goacross the gap,hewillbegin todespair. That

is the usual spiritual way. But our spiritual way is not so

idealistic."7

(23)

"The Interconnected Branches InteriorMural"

(24)

The Interconnected Branches Interior Mural

WhiletheRoots Scrollwas meanttoserve as a symbol forone's nostalgic searchfor

anideal, the conditionsspawningthisphenomenonare representedintheInterconnected

Branches oftheinteriormural. Printedon wallpaper and pastedto the wall, this8x 10

foot image plays withthe viewer'srelationtohissurroundings. It has becomea popular

idea intheculture ofpostmodernism(thanks inpartto thephilosophyofKarlMarx) that

ourcontemporaryeconomic situationhasplayedalarge roleintheindividual's

conception ofthe self withinhisenvironment. Forexample, theadvent oftherailroad and

theautomobile engine created a world much smaller andfarmore accessiblethanit had

beenacentury before. The contemporary landscape is defined largelybythespeed in

which we passthroughit. In today'stechnologywithits high-speed Internetconnections

and variations ontelephony, we are ableto transcend spatial barriersas well astime

delay. Thistechnologyhas broughtto oureconomywider coverage andless dependence

upon physical presence.We are more concerned withthe changesoccurring inmarkets

outside our ownimmediacy. The phenomenon ofglobalization,followingthe

abandonment ofthe gold standard, instigatedthede-materializationof physicaldistance.

Thisphenomenon canbeseenin toady'sfloatingexchangerates where all currencies are

nowinterconnected. Likeitornot,industrializednationsareinthis together.

WhiletheideaoftheGlobal Villageis a clichein itsemphasisoncommunity, the

conditionsthatcreatedit greatlyaffecttheindividual.Our disconnectionfromplace

engineersanenvironmentlackingboththephysicalityandgrounding ofplace.Justasthe

lackofgravitycausesosteoporosisinastronauts,Globalismcreatesa universalized

societythathas little regardfortheprevious

generations'

centers of culture.This lackofa

central urbanlandscaperesultsinurbansprawl.Traffic,thelackofsidewalks, and gated

communitiesareallthe productsofthegloballandscapewhosephysical connections

create alackofsocial connection.

ThebranchesoftheMural lullthe viewerintoafalsesense of comfort. Iwas very

happytohearpeopletellmethatittook themupto30minutesofbeing aroundtheimage

to realizethat somethingwas

"wrong"

withit.Theyhadthoughtthis wassimplyapretty

picture oftreebranches againstthe sky, andthatitsgreataccomplishmentlayinthescale

and renditionofcolor,coupled withthenebulousideaofbeing"well

composed."

Whatappearedto beaworm's eye view ofthefloweringtreesofspringwas, infact,

acombination ofimages (40to 50)seamlesslycollagedtogether.Branches were

connectedin illogicalways, andspaceswerereconstructedtojartheviewer's sense of

rational perspective. Itwaseasyto inducethis response; I used myself as an example of

(25)
(26)

someone who has verylimitedexperienceswiththe

organic world,andtried togive

myselfjustenoughinformation torelate to

myownidea (or memory)ofhow ascenelike

this should appear. Oncethe original suggestionwasvisually inplace,Iwasfreetoalter

asmuch oftheimageasIwanted. Whenthe trickbegan torevealitself, Iwould either

backofffromor strengthentheparts oftheimage thatgavethe suggestionof normalcy.

Withthis imageinparticular,Iamchallengingthevieweron twowidely heldtruths:

first,ourbeliefthatphotographsaretruthful documentsoftherealworld,andsecondly, a

strongerandeven primordialbeliefthatthenaturalisauthentic.Addressingtheformer: a

photographis supposedlyatwo-dimensional depiction inlight,formand color of a scene

fromoneviewpoint. It iswhat wehave beenconditionedto see;it forms ourwayof

organizingthoughtsintoa cohesive and rational reality.Withregardto theauthenticity of

nature,our society'scurrentinterests inorganicfoodand naturalproducts,"eastern"

medicine, yoga,andrealitytelevisionindicate thatwe needtohavethebelief,if only in

appearance,that there aresome areas which shouldn'tfallto human intervention. There

isan almost religiousmentality thatnatureis recognizably distinct fromman-made

reality,andthatit ismorevaluable,as evidencedbytheexamples of organic apples and

free-rangepoultry. Cezannesaid almost 100 years agothatwhen we seetheland, all we

see are pictures.Personally, I have seenfarmore pictures ofland thanIhave seenthe

land itself.

Eachof ushas adesireto believethatwhatispicturedis real;averification of our

place withintheworld. Iwanted tomake animage thatacted as a metaphorforour

cultural

"placelessness"

andlackof grounding. Intheimages fromtheprevious year's

workIbegan tostrip away thebackground fromtheimage and slightlyaltertheformof

theorganic objecttoprovide afeelingofbeingremoved andhidden fromthe

environment.

TheBranches, morethananyother ofthese pictures, usedthetechnology ofAdobe

Photoshoptoform themessageoftheimage itself. Photoshopprovides an easy wayof

seamlessly montaging imagestogether.To connecttheroots I usedthesametechnique,

howeverastheobject was removedfromthe largerscene thespatial effects created by

this type ofmontageingwerelargelyhidden. This methodiscommon toPhotoshop,and

my interest lies in combining many separate points of viewintoone image.

Perspectivehas taken severalformsin its codification sinceitsrevolutionary

one-pointlinearperspective oftheRenaissance. Fromthecontinuationofthatcodificationin

photographytoCubism'srejectionofits conventions, thisnewtechnology enables us to

arrange several

"modern"

(27)
(28)

Linearperspective makes certain assumptions: namely thatimagesaredisplayedflat

on acommonplane, thatthe artist sawthe scenefrom afixed point of view with a

singularand objectiveeye,andthat there isa pre-determined point of view inwhichto

lookattheimage. AsPanofsky said:

Inasense,perspectivetransformspsychological space into

mathematicalspace.Itnegatesthedifferences between frontandback, betweenright andleft, between bodiesand

interveningspace

("empty"

space), sothat thesumofall

thepartsofspace and allitscontents are absorbedintoa single "quantum continuum."8

Whilethistypeof perspective makes thatoftheviewerthedeterminingfactorofreality,

thenew technologycan alsoplay withthisidea. Astheideaof cultural placelessness

affectstheindividual's sense ofdeterminingreality,IfoundthatintheInterconnected Branches Iwasillustratingthispointbygenerating a sceneinwhichtherearemany

points of view.

There isno one visual point of referencein whichtoseethepicture.The picturehas

illogicalforeshortening and an absurd sense that therules ofthenatural world have

somehowbeen broken. The large-scaleofthebranches fillsthe viewer'sfieldofvision,

as wouldthenatural scene,yetthe viewer cannotfindan anchor or reference. Seeing

several vanishingpointsconcurrentlyandhavingmultiple picture planesinspires a sense

of vertigothattheviewer must reconcile in hisownimagination. Becauseofthewealth

of similarimagestheviewersees, thisprocess of reconciliationis immediate; the

narrative ofthebranches is revealingofthe trick thathismind hasplayed uponitself. It

was aslight-of-hand gagthat turned thesubject ofthepicturefrombeingaboutthereality

of nature tobeingaboutthenature ofreality.

Myvisualinspiration forthistypeof picturelies inthelandscapescreen paintings

fromtheEdo periodinJapan. Screensare similartowallpaper murals intheirshared

historicalpurpose ofinteriordecoration, andas such aretotemsindicativeofthe

prevailing socialstructure.As theTokugawaShogunategainedpolitical control over

Japan inthe 17thCentury,the socio-culturalhierarchywentthoughdrasticchanges.A

society offeudal imperialistsperpetually at warbecame more unified andpeaceful; and

Japan's economyprospered.

Astheweight of war removed thestronghold ontheurban merchant class(alongwith

therapid growth oftheurbancenter; i.e., Edo-Tokyo),thereemerged a new set ofluxury

goods,popularart,design, andentertainment.A decadent culture arosein strongcontrast

to thepiousfeudal society thatpreceded it.Fashion, entertainment,brothels,and other

(29)
(30)

pleasures werethe new motifsexploredbyartistsintheirdepictions of society. The

conceptofUkiyo-E(floatingworlds) wasintroducedto describethefeelingsofthese

pleasures. Whilethereis astrongcorrelationtoKabuki (puppettheater)in thefloating

style ofUkiyo-E, the land itselfalsofloated. Hills,trees, and water were represented as

separate andautonomous elements disconnected from their surroundings,befitting the

carefree andpleasure-seekingphilosophy ofthe time(albeitcommissioned bythenew

government).

Thesimilaritiesare striking between EdoperiodJapanand ouryouthculture oftoday.

The popularityof cocaine inthe 1980s gaveway to thatofEcstasy(MDMA) inthe

1990s, and withitcame a culturethatwantedto beentranced andlost inmusic and

celebration. Inhis Tales oftheFloating World, Asai Ryoi says ofhistime

"..

.Livingonly forthe moment,turning ourfullattentionto

thepleasuresofthe moon, the snow, thecherry blossoms

andthemapletrees, singingsongs,drinkingwine, and

diverting ourselvesjust infloating, floating, caringnot a whitforpauperism staringusintheface,refusingtobe

disheartened, likea gourdfloatingalongwith theriver

current:thisiswhat we callthefloatingworld."9

Cyberspace today representsthe fleetingattitudethatmany ofmy generationpossess.

Itwould seemthatin both theglobalism oftodayandtheisolationismin Edoperiod

Japantheattitude ofapathy ispredominant. Whilefor EdoperiodJapanthepurpose of

thelandscape screens wastogive animpressionistic descriptionof"here I am,"

the

(31)

"The Mountain RangeBackdrop" or

"The GravelPiles"

28.5x140 inches(paneled)

(32)

The Mountain Range

Backdrop

Iused tolove westerntelevisionshows such asRawhide,KungFu, and The Lone

Ranger, alongwiththefilms ofJohn Wayne. I feltthatIshared theirsolitary spirit.I had

thatsameunderstandingofbeingalone,ofbeing"out

there"

asthey were. Maybeitwas

theinfluenceofDisco,whosethemewasdancing alone,or maybeIwasjusta

melancholy kidwho spenttoomuch timewatchingtelevision.In eithercase,I could

relate.Lookingbacknow,with theeyes of someone educatedinwesternlandscape

painting,I seethatStarTrek, Star Wars, andLostinSpacewere examiningsimilarideas

aboutthefrontieralbeit updatedfor contemporary times. Moreover,Ifeltthat theattitude

aphotographerhad to takewasthatof alone gunman,movingabout ahardroador

grassy knoll,on a questfor... something. I neverknewwhatthesecowboys werelooking

for,but I wastold thatitwasthequest alonethatmattered. Manyyears later, readingJack

Kerouac's OntheRoadconfirmedthevalidityofthisidea. Yearsafter that,whilehiking

inthe Sinaidesert, withBedouinand camelsreplacing Indiansandhorses I finallygot a

taste ofthewild and ruggedlandscape which theLone RangerandTontohad inhabited.

Myvision ofthatscene wasinfluencedbywhatI hadwatched 20years earlier on

television.

Thefinal incarnation oftheMountainRangeBackdropwas atribute to my

television-inspiredview oftheland. It began simply throughphotographingthose ubiquitous piles

of gravel thatseemto litterthe Rochesterarea. What I saw onthe contact sheets was

compellingfromthebeginning;the gravelhad beentransformedintohills, dunes,mini

mountains, androlling fields. Byaddingcolor, Icouldturn these scenesintoanyplace

imaginable. I learnedthen thatcolor equalstheme;and sincethemeinthiscase wastied

to setting,I could changethesetting bychangingthecolorsofthegravel. I thoughtof

the cowboy, who carriedthemyth ofthe wild, untamedland asabackdropfor his own

wild, untamed nature. Assuch,I became thepicture-makingcowboy.Clint Eastwood's

archetypal questin his various portrayals ofthecowboy wastomake thelandand notbe

subjected toit. I figured thatiftherewas no cowboy, thanno camera wouldbe

photographing himagainstthewestern backdrop.

There isareciprocalrelationship between wildness anddiscovery. Examplesforthis

ideaareabundant: the childrenofIsrael wanderedin theSinai before comingto their

promisedland,Jesusand other mystics went to thewilderness tobefore resolving problems, theAmericanIndians tookhallucinogens inreligious ceremoniesinorderto

communicatewithdivinebeings, and artistscontinue timelessly tograpple with"the wild

side"

beforeformalizingtheirideason canvas or on paper. Whileitwasthe western

(33)
(34)

wildernessofmountains,Indians, deserts,valleysand gorgesthatshapedtheAmerican

consciousness, itwasthrough thetamingofthefrontierthat the real Americanidentity

wasfounded. Thetopography ofthe west,despitebeinga place of peril andfear,was

also onethatofferedmany natural resourcesof greatbenefitto

burgeoningAmerican industries.

Toprovidethe readerwith abrief

backdrop

ofthe literaturethatinfluencedme, itwas

not untillaterthatnatureitselfbecameasource of pridetoAmericans. The footprintof

Europeancivilization uponthe"NewWorld"

transformedthiswildernessintoan

environment ofpossibility; a virtual GardenofEden. While themagnitude ofthe

landscape served as ametaphorforthe grand plansto the continent, italso served as a

metaphorforescapefromthe confinementofEuropeanoppressionleft behindby the

immigrants. In John O'Sullivan's article onManifestDestinyhepoints to thelandas a

place where a new society canbe built:

"Theexpansivefutureisourarena, andforourhistory. We

areenteringon its untroddenspace, withthe truthsof God

inourminds, beneficentobjectsinourhearts, and with a

clearconscienceunsulliedbythepast. Weare thenationof

humanprogress, and whowill, whatcan,setlimits toour

onward march?Providence iswith us,and noearthly

power can. Wepointto theeverlastingtruthon thefirst

pageofour nationaldeclaration, and we proclaimto the

millionsofotherlands, that 'thegatesof

hell'

thepowers

of aristocracyandmonarchyshall not prevail against u:"0

Transforming the wildernessinto a cultivatedlandscape meantembracing theWildas

a concept.This concept wasillustratedbypainters such asCole, Bierstadt,Church,and

Moran; and wasfundedby theUnitedStates Government. Thomas Moran,who had

worked asChief Illustrator for Scribner'smonthly,hadenough political pull to gain

accesstomost parts ofthe Westatwhichtimewas beinglobbied bycongress as national

park recreational landfortourismpurposes. Fundedby JayCooke,the Presidentofthe

Northern PacificRailroad,Moran set out onthe geologicalsurvey expedition of

Ferdinand Hayden in 1871. Whilethetripwas essentiallya public relations campaignto

fostermore curiosity innatural wonders such as theGrandCanyonandYellowstonefor

thebenefitofthe railroad,Moranin hiswork underscoredthis sense of wonder.His

paintingoftheGrandCanyon, boughtbythe UnitedStates Government for$10,000,was

(35)
(36)

"Iplace no value uponliteraltranscriptionsfromnature.

Mygeneral scopeisnotrealistic;allmytendenciesare

towardidealization. "

In Moran'spainting,alongwith thatofmanyothers, the myth of our national

character asAmericans is built. Onreview we can see how theseideaswere crafted: the

ideaofthemountainis symbolicfortheheightsconceivable bythehumanmindin its

questforsafety, security andentertainment.

The depiction of naturein alandscape isconnectedto theideaofownership;whether

thatnotionlies inphysical and political boundaries,likethoseoftheAmericanFrontier,

orthepossession ofthelandas setting for human drama. We usethelandanditsorganic

elementssymbolicallyto enrich our stories and create our myths.There is also,however,

abiological aspecttolandscape representation,which supposes an evolutionary

preferencefor landtobe "owned"

in some sense.

There have been scientifictheoriesstatingthatour visual preferencesforcertaintypes

oflandscape derive fromourevolutionary needs. Savannatheory (Habitattheory)

proposes an obvious conclusion thatour choice of environmentis dependantupon our

abilitywithin ittoforage for foodand seek shelterfromtheelements. Scientific studies

conductedin children(whosepreferences wouldsupposedlyreflectinstinctoverintellect)

onthe typesoflandscapestheypreferred showed aninclinationtowards landscapes

similarto those oftheAfrican Savanna (inwhichit is thought thatmuch ofearly human

evolutiontookplace).

Theaesthetic elements oftheAfrican Savanna include water, treeswithbranches

beginningtwometers offthe ground,avariety of woodedand clear areas(placestohide

and/orescape), and paths which comein and out ofview providing areas of

exploration.12

Whilethisattitudecanbe seeninpost-Renaissance landscape designof

parks and gardens,italsoholds truefor depictions offine-art landscape. The Russian

artistsKomarandMelamid conductedopinion pollstodetermine styles ofpainting

most-andleast-preferred byWesterncountries,andthefindingswere striking. Thevast

majority of countries preferredlandscapepaintings whose attributes mimicthoseofthe

Savannatheory polls: therepresentationof availablefood (animalsandplants), water,

shelter,andclarity of vision.

More strikingwasthepreferenceforthe depictive styleoflandscapesoftheHudson

River School. Inthese landscapesthereisalarge landmassin thedistantleft, abodyof waterin the middle, treesonthe right, and aclearing inthefront. Perspectivewas placed

highoffthe groundand withpredominantly blue

skies.13

Giventhisresearch andthe

mythology surroundingdifferenttypesoflandscapedepictions,alongwiththeinfluence

(37)
(38)

ofthetelevisedlandscape,it isno surprisethat theillusorylandscapeprevails inthe

Mountain Rangepicture. Itstatesvery clearlythatlandscapes are man-made phenomena and nevertruly "natural." Thispictureis forme themost successful ofthe seriesinthis

regard; theimagewascreatedbyphotographing landscapingmaterialsto builda

mountainmore convincingthanaphotographof a real mountain.Thelandscaping

material becametheimagebuildingmaterial.

I feel thatmy imagesconjureupnegativeideasabout man's relationto the organic;

anunderlyingthemeofdestructionandthemanipulationof a realmlongdeemed

untouchable contrastswiththebeautyand precious qualityofthesubject.The Wildlands

Project,EarthFirst, andGreenpeace are all noble causesforenvironmental protection,

espousingtheideathatwithout a natural wilderness our cultural sense of connectedness is lost. Their sometimesradical attempts at

"saving"

nature canbe seeninthe same heroic lightasthosepioneers whose drive itwasto "tame"it.

TheGaiatheory ofJames Lovelockpurportsthat theworldisalivingorganism, and

thatashuman beingswe are a part ofthatsystem.Yetmorethananyotherlife formon

Earth,wehave been abletochange and manipulatetheenvironment. It seemsthat the

natural process of adaptation and evolution arelawsreservedforthe other,

"lower"

life

forms.Seemingly,manhas defined himself inoppositiontonature as a defenseagainst

thepsychic crush ofhis inevitablyshortlife. Forexample, societiesthroughouthistory thatrespectedthe environmentfell to those thatdidnot.Thosesocietiesbycomparison weretechnologicallylessadvanced, theirpopulationspoor, andtheirattitudes we today haveranked as

"natural;"

whichtranslatesintomoreanimal, thanhuman. Itwas away forjustifyingnotonly the genocide oftheAmericanIndians, butalso ourantipathy for

theevents inthe underdevelopedportionsofthe world. Itisa product of ourfearof naturethatwe embarkupon a pathtore-create theworldforour consumption. It is

racism, and

"anti-nature."

In reality, we are mostpowerlessagainstthelawsof nature. Regardingourcrops,our picnics or ourwars

natural lawsmake thefinalanddispassionate decisionsforus. For pre-modern(pre-Renaissance)man,naturehadan entirelydifferentconnotation. Ideas such as picnics and walks intheforestwereanathematohis wayofthinking; hewas bound tonatureinthe same waywe areboundto our workplaces.Kenneth Clark,when

discussingmedievalman states:

"Theaverage layman would nothavethoughtitwrongto enjoy nature;hewouldsimplyhavesaidthatnature was notenjoyable. The fieldsmeantnothing but hardwork...

(39)

beyondthesemore orlessprofitable partsoftheearths

surface stretched an interminableareaofforestand

swamp."'4

Thefactorthatliberatesusfromourfearof natureisour newfrontier,technology.

Whetherinthe production ofcrops, thedomestication ofanimals,orthe harnessingof

naturalforcesandresources,technology hasgiven us given us a sense of power while

facingthesefears. It hassofar,despiteafewunfortunateaccidents, helpedus livelonger,

healthier lives. Ourtechnological innovations haveallowedustoinhabit everycornerof

theearth and exploititsresources, providing forus abackgroundinwhichwe canhave

an experience of nature while remaining comfortedbyourabilitytoleaveit.

Landscapehas becomean

"e-escape."

This ideaoftheorganichas rapidly evolved

alongwith our owntechnological evolution. Asthemallhasreplacedthetown market,

our relationto thevisible andtangible has beenaltered as well. The Mall hasmade our

physicallimitations of accesslessproblematic,bygiving us adesirefor increased

accessibility. Inthis turnhasprovidedforus aframework in whichtoview nature one

whichis optimized,sanitized andready forconsumption.

(40)

"Circular Rainbow InspirationalPoster"

18.5x24 inches

OffsetlithographyPoster

(41)

The Circular Rainbow Inspirational Poster

It is fairtosaythatfromtheir onset, depictions of naturehavealwaysbeensymbolic.

There isadriveto transform nature, whetherin

bioengineering

orinart. The earliest of

landscape motifsinmedievalartemployedtheorganic asrepresentations ofideas. Itwas

thoughtof as acarryoverfrom Hellenistictimes thatcognitiveabilitywasfarsuperiorto

sensory stimulation.In theJudeo-Christiantraditiontherainbow wasthefirst symbol; a

signfrom God toNoah afterthefloodthathewouldnotdestroy theearth andits

inhabitantsagain; itwas thecovenanthemade withtheearth. To manyother culturesthe

rainbow cametosymbolizethe ultimateharmonyoftheearth incontradistinctiontoa

great natural disasteror as abridge fromthe lowerto theupper worlds.The Buddhists

view therainbow asthe higheststate ofsamsarabeforetheclearlightofNirvanaas well

asrelatingtheseven colors ofthearcto theseven planets.

Ultimately, therainbow is a"bridge" betweenthenatural andthesupernatural, the

earthlyworld andthehigherworld, theworld ofsymbolizingour environment andthe

world of representation.Butwhathappenswhentheoptical puzzle, themystery behind

thephenomenonhas been discovered? Justas questions offreewill are re-examinedin

thefaceofDNAsequencing, the rainbow serves as anAtlantis: Itsnostalgic component

funnels it intotherealm ofkitsch. It has becomeafailed symbolinthefaceof ozone

depletionand globalwarming, carbon monoxidepollution, overcrowdingand a hostof

new diseases.

I madethe Circular Rainbowto symbolizethefailureofthemythic symbol,while on

theotherhand itrepresentsthenewfrontier. Ifthereis a pot of gold attheend of a

rainbow, a circularrainbowrepresentsour continued search.Technology haschanged our

conception ofreality intheway itprovidesforustheexperienceoflivingwithout

needingactual life. Tangiblenatureisno longerneededintheera of computer

simulation. Contemporarybiological researchis donepredominantlywiththeaid of gene

sequencing and chemical analysis.Thecomputerhasaided ourunderstanding ofthereal

as well as madeitobsolete.Thevirtual environmentis our nextfrontier,and perhaps it

willbetheonlyplaceinwhich we canlive our owncreationbecomingtoounnaturalto

sustainhumanity.

Makingthe Rainbow imageprovedfarmoredifficultthanI couldhave imagined. It

provedthatmakingsomethingappear simpleisextremelycomplex,involvinglotsof

complicatedstrugglingandmanipulating.Making somethingappear complex requiresthe

(42)
(43)

fluctuationsof one'shand. Thepicture wasmeanttoappeareffortlesswiththe simplicity

of a snapshot

somethingjust seenand recorded.

Circularrainbowsdohappennaturally; theyarevisiblefromairplanes.A classmate

of mine whohadwitnessedthison aflighttoldme aboutit, andI instantlythoughtthat

thisrepresentation would fitwith mycurrent themeofsentimentalandfabricated imagery

of nature.Acoupleofweekslater, I saw andphotographeda rainbow inthesky and

knewthatI had mysourcematerial. Tomakethepictureconvincing, theshape couldn't

be perfectlyround northe lightuniform.I hadto shapethe brightnessandthe saturation

oftherainbow withinthe sky,which alsohad its own undulationsofcolor,density,and

depth. An apparentlyclearskycontainsinfinite colors and values and a rainbowis part of

thatscheme.I canhonestly saythatI gained greathumilitythroughmakingthis picture,

recallingsome ofmy Taoistreadingsabouttheinterconnectednessofeventsthatboth

therainbow andtheblueofthe skyare neverisolated inform, butpart of atotality of

experience,linkingthe object withthebackground.

There was avery fine line between makingtheillusion appearconvincingly

"natural,"

andhavingit lookdigitallygenerated.There hadtobe imperfections inthe

circularityas well as afluctuation inthecoloringto createsomethingthatappeared real.

This challenge illustratedwhat Lao Tzu hadwritten millennia ago about"true

straightnessbeing

crooked."

Itseemedtomethat to sustainthefeelingof correctnessin

the appearance oftheimage, Ineededtopresenttheviewer withsomething incorrect.

There isan unconsciousleap offaiththatwe make whenlooking attheworld: it is

ourwayofrationalizing its inconsistencies, anditgives ustheillusion of normalcy.A

slightly imperfectcircle presents a catalystfortheviewertoimaginea perfect one. Ina

sense, thatiswhatthe rainbow symbolizes: we use anillusionto create anillusion. With

contemporary technologies,however, thedivisionbetween truth andillusion has become

highlyblurred. This isthe cybernetic notionof a circularcausality,createdtoprovide

machines with more efficientdatawithwhichtoact. Computers are machines withthe

abilityto "selfmonitor"

soasto becomemoreefficient,andina sense act(accordingto

theGaiatheory) as a self-sustained organism. Resolvingdatasystems withthenatural

systemisasteptowardsbecomingless dependantupondirecthumanperception.In

incorporatingcomputertechnology,wehaveplaced ourselvesintoa symbiotic

relationshipwith thevirtual: we control itanditcontrols us. PerhapstheY2Kfiascowas

ourfirstconcrete exampleofthisphenomenon.

The"space"

createdby theInternethasprovidedus with theabilitytocommunicate

andhaveexperiences withoutthe limitationsofmovingour physicalforms. Ifourfocus

in theadvancementof civilizationhasdependeduponknowledge,than the virtual

(44)

A

\l
(45)

platformpicksupthe pace withthespeed andaccessibility it has provided. Withoutthe

confines ofthe body,the mindis freeto observe andhaveadifferenttypeofinterface

withotherminds;more information ispassed morefreely.Combining thiswith

technologythat can actindependently, a newfrontier, orwilderness, is limited onlytothe

(46)

"OilonCanvas (engineoil onpavement)"

9x14.5 inches

Inkjet (iris print)oncanvas

(47)

Oil on Canvas

OilonCanvas is perhapsthe mostdifficult image to talk about; itwas themost

complicatedimagethatImade, and embodiesformethe sum ofthedystopicaspects of

ournatural world. Itwas madeinresponse to therainbow imageand was madein

referencetomyreadings ontheconcept ofthe Sublime.

I felta needin my thesisworktoprovide alargerpicture ofthe elements,which for

me representthenatural in ourtimes.I feltthathaving adisplay ofprettypicturesonly

gave part ofthe story. Ineededtomake animage thatwas in directoppositiontoall

other pieces I hadmade previously.I alsowantedto give myselftheopportunity toplay

with an edge with whichI feltuncomfortable.Thepurpose oftheotherimageswas to

relateinformation through pleasure, tolulltheviewerinto beliefordisbelief,and to

providefor hima platform wherehe couldfeelat easein viewing how I sawtheworld.

OilonCanvas attemptedtoremovethis platform and presentits ideas innakedform.

Likethe rainbow, OilonCanvas is anillusion: the colors we see are simple

refractions oflightonthesurface of an oil slickthatI found in aparking lot. Thecolor

couldonly be seenincertain parts oftheoil atanyone giventime,andto gain a picture

oftheentire object one hadtobemovingoverit. I wasdrawnto the shimmering surface.

Ithoughtabouthowtheobject was atthesametimebothnatural andman-made, and

wantedto representthis semi-miraculous, semi-banal objectinone picture. I createdit

byphotographing only theparts oftheoilthatreflected thelightmostintensely andlater,

withPhotoshop, seamingthosepartstogether. Iwas struckathowwhatI wasmaking

lookedlikepaint oil paint butthereal colorwas made upoflight. Itseemedto

embodypaintingandphotography, themoving image andthe still, thenatural andthe

man-made.Itwas at onceboth beautiful andterrifying.

The image is amorphousthe

opposing forcesthatholdtogetherourideasofformal

beauty. Readingaboutthe Sublime, I was struckbythe 19thCenturypainterJ.M.W.

Turnerandhispresentationofexperience;his sense ofdangerand excitement conveyed

to theviewer viahispaintings. Turner displayedtheincomprehensibleas a representation

of pure energy. I wasinspired bytheway in which thedepthofhis skies appearedto

proceedfrominfinitytowards thepictureplane, toeventuallyoverpowertheviewer.The

Sublimewasthat which, as opposed to beauty,calledintoquestion our notion of comfort

andsecurity inthevisible world. Imagerythat connotes,or conjuresup, thehelplessness

thatmanfeels inthefaceof great natural events(storms,darkness) callsintoquestionthe

essence of ourfreedomand autonomy. Butthesublime was also a romantic concept. It

came about as thecelebrationoftheindividualwithits pull away fromarationalist

(48)
(49)

<t*f*RF-mindset. Itshowed usthatwewere ontheedge oflargerdiscoveries, that thefear involvedneededto be,ifnotunderstood, deservingof attempted expression.

TheSublimeinart oftheromantic period was an eventthat tookplacethrough either

Nature's power or events ofhistoric myth.Itwashappening outsideof man's control and

placed inthehands oftheCreator. Itreferenced ourage ofdiscoveryandinvention,andit wasthought that true understandingofthepower ofthedeitywasto be found inthe

examinationof

"pure"

creation.Thoreauwrotein Walden in 1854:

"Godhimselfculminatesinthepresentmoment,and will

neverbemoredivineinthelapse ofalltheages.Andwe

are enabledtoapprehend at all whatissublime and noble

onlybytheperpetualinstillinganddrenchingofthereality thatsurrounds us."15

DuringWorld WarII,Americanartists oftheAbstract Expressionistperiod also

became interested in the sublime,yetforthem the reference wasentirely different. For

them thesublime connoted not anexternal,naturalfear,butan unknown ofgeography

and religiouspowerbutafearoftheinternal,

the unseeable,andtheseeds of man's

poweroverhimselfand others. As Freud'stheory oftheUnconscious hadpurportedthat there are areas ofthemindthatare at work without our cognitiveknowledge, and

Einstein'stheorieshadtoldusthatmass andenergywereinterchangeable,theparadigms

of our sense of self and placehad radicallyshifted. Theparadigm ofreality hadshifted

fromwhatThoreau hadmentioned, andthesublimein late Modernismexpressedthe

positionoftheviewer's mindbeyondthatofhis senses.

But how is it reallypossible todealwiththesublimetoday withoutfallingintothe

ridiculous?Ifthesublime assumes a soulfromwhich theindividual can experience"the

event,"

is itpossibletoreconcilethese"experiences" in lightof an existence wherethe

bodyandthe soulhavefallenout of contact?Socialconditionshave created anindividual

whose experiences arelargely virtualandtherealitythat surrounds usis largelyman

made.Thereare ofcourse new frontiers,new events and concerns which reachthelevel

ofbeingworthyof representation inthe Sublime intheromantic sensebut thatis for

theromanticsto workout.I had knownallalongthat theprospect ofcreatingthe Sublime

wasfutile; thatallIcoulddo isre-create and useits motifs.

Inshort,I hadmade asouvenir, a representationofthe"good old

days"

when nature

waspainted,andpaintingwasnatural

an image tohonorthelostera of creation withthe

(50)
(51)

fascinationwithbeingde-mystified,withthesuppositionofthe unknown andthetaming

of ourfears.

(52)
(53)

The Exhibition

BrianEmery andI decidedto combine our workto create atwo-manshow.About eight monthsbeforetheexhibitionwehad decidedtocombine our worktogether to createsomethingotherthanadisplayof pictures we wantedto presentourideas as a totalexperience and make a show thatjointlyexplored a singleidea.As bothour styles of workdealtwiththemanipulatedenvironment,wefeltthat the show neededtobecomean environmentin itselfthatwould mimic our collectiveidea.

Ouroriginal designsfortheshow were quite grandiose;its production wouldhave

beenhighlyexpensive and complicated. Forexample, thefirsttitlefortheshow was"A walkthough the city andintothe

garden."

Itwasintendedtomimic a museum exhibit where Brian'sstreet scene panoramas would beprintedlargerthanlifeanddisplayedin

cramped passagewaysthroughwhichthe viewerwould walk. Thecanvas would

physicallyencompassthe viewer; thus mimickingthefeelofstrolling down thecity

block.Mywork was tobepresented inan open space wheretheviewer would stand or sit at adistance ina relaxedenvironment,and could simply enjoythe scenery.We drewup some schematicsforthe show, designingthegallery space andchoreographingthe

viewers'

movements so as tocontinuewiththe themeof subtle manipulation. Whenour exhibition conceptbecamemorerealistic, we understoodthat the city/gardenideawas a muchlargerconceptthan thatwe weredealingwith.Takingall thisdowna notch we

begantounderstandthatBrianwaslooking atthe StreetandI was lookingatthePark. Mostofmy ideas begin thisway.They start with a muchlargerconcept of whatis

reallytherewhichfrees mymindtodreamof all ofits possibilities.Only later dothe

ideasget cleanedup andfileddown, presentingthereal idea ina morehonestanddirect format. Justasmypictures(liketheprocess ofphotographyitself) are subtractive,my

methodisto beginwiththelargeandrough, and workmy way downto thefine.

BrianandIwould spendtimebrainstormingonhow theconcept of our work needed tomanifestitselfphysically,butoncethefinal ideawasdecidedupon we would spend

longhours together,workinglate intothenightonthephysical pieces.Much of ourtime was spent atHomeDepot, making decisionsonthe types ofscrews,lightfixtures,paint colors and such neededtomounttheexhibition. Weworkedtogether, lookingover each other'simagesforcorrections, andoverseeingeach other's progress. I havenever worked

this waybefore;Ihadalways workedalone,andI cansay thatbeing insuch an

environmentalthough stressful was also extremelyhelpful. By having anotherperson

(54)
(55)

areasthatone of us was more skilledinthan the other, we were abletohelpone another

realizehis ideasmore quickly. Mostly,thebenefitofthiscollaboration washavinga

partner with bothanimpassionedand objective eye.

(56)

Conclusion

I wouldliketo quotefromthe exhibitionstatement, wh

References

Related documents

My vision is that we build a knowledge graph to represent scientific information, linking data that have been traditionally represented in text to open up research.. It would

Puede que su equipo no tenga suficiente memoria para abrir la imagen o que ésta esté dañada. Reinicie el equipo y, a continuación, abra el archivo

Though the combination of evangelism and community service aren’t new, the denomination is promoting the initiative as an officially suggested option for youth outreach

Dengan metode ini, foto yang sudah di-learning akan dicocokkan dengan hasil deteksi dari streaming kamera dimana pada streaming nantinya beberapa gambar dalam database

Certification • Certificate of Completion in “Executive Program In Human Resource Management” from IIM Lucknow...

Second, we define a summary prefix tree, a trie data structure used to build a scalable, fault-tolerant and robust over DHT index for keyword-based search.. Third, we define an

Appendix A shows that the SST and atmospheric interannual variability (vorticity, shear, tropospheric moisture...) has a greater impact on TC activity than oceanic

From a web-based Virtual Terminal (accessed through your computer) to payment processing via your smart phone - and many, many other options - your Account Executive can help