Rochester Institute of Technology
RIT Scholar Works
Theses
Thesis/Dissertation Collections
2004
Into the park
Joel Lederer
Follow this and additional works at:
http://scholarworks.rit.edu/theses
This Thesis is brought to you for free and open access by the Thesis/Dissertation Collections at RIT Scholar Works. It has been accepted for inclusion in Theses by an authorized administrator of RIT Scholar Works. For more information, please [email protected].
Recommended Citation
Into the Park
Submitted in partial consideration of a Master of Fine Arts Degree in Photography
Joel Lederer
Rochester Institute of Technology
Rochester, NY 2004
Jeff
weiss _ _
J_·
W_e_i_ss _ _ _ _
'f_,_!
B~,
_o_7
__
_
Willie osterman _ _
W_._O_s_t_e_r_m_a_n ___
0-
_.
/
....:.~_
.
_
.L!.
_
/
_ _Elliott Rubenstein
s
/
f
/
/
o
f
}
7
Thesis/Dissertation Author Permission Statement
Title of thesis or dissertation: _ _ _ ..l-_rl_';O _ _
---.:.~--=-:~E.~_\?.:..._.:I}~Q..._K-~
_ _ _ _ _ _ _ _ _Name
~f
author:-:-~~7'r'--_
2>
t.""'-
>
~L.=--_....:::l:::....t.=
·
-~\j~~:::.\2..!._.::Jc;.=__~~
_ _ _ _ _ _ _ _ _ _ _ _
_
Degree.tI\
F
tE
Program: tv)
F
A- _
\J
I."cl:J1 «,(l:=College:
C.
r
as
-
'Vc)c'vo~!/2-
r NSI' [....)1"< ,./-r
o c:..\"'NcJloS1
I understand that I must submit a print copy of my thesis or dissertation to the RIT Archives, per current RIT guidelines for the completion of my degree. I hereby grant to the Rochester Institute of Technology and its agents the non-exclusive license to archive and make accessible my thesis or dissertation in whole or in part in all forms of media in perpetuity. I retain all other ownership rights to the copyright of the thesis or dissertation. I also retain the right to use in future works (such as articles or books) all or part of this thesis or dissertation.
Print Reproduction Permission Granted:
J,
.3'
,-,
£L
Leo£~eiL
,hereby grant permission to the Rochester Institute Technology to reproduce my print thesis or dissertation in whole or in part. Any reproduction will not be for commercial use or profit.Signature of Author: _ _ _
J_o_e_I_L_e_d_e_r_e_r ___
Date:/VI) \
&
-
2-0
04
Print Reproduction Permission Denied:
J, , hereby deny permission to the RIT Library of the Rochester Institute of Technology to reproduce my print thesis or dissertation in whole or in part.
Signature of Author: _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ Date: _ _ _ _ _ _
Inclusion in the RIT Digital Media Library Electronic Thesis
&Dissertation
(ETD
)
rlrChlVe
I, ' additionally grant to the Rochester Institute of Technology Digital Media Library (RIT DML) the non-exclusive license to archive and provide electronic access to my thesis or dissertation in whole or in part in all forms of media in perpetuity.
I understand that my work, in addition to its bibliographic record and abstract, will be available to the world-wide community of scholars and researchers through the RIT DML. I retain all other ownership rights to the copyright of the thesis or dissertation. J also retain the right to use in future works (such as articles or books) all or part of this thesis or dissertation. I am aware that the Rochester Institute of Technology does not require registration of copyright for ETDs.
I hereby certify that, if appropriate, I have obtained and attached written permission statements from the owners of each third party copyrighted matter to be included in my thesis or dissertation. I certify that the version I submitted is the same as that approved by my committee.
Introduction
Mythesis exhibition, "DowntheStreetandIntothePark," wastheculminationof
several yearsI spentexploringthe subject oflandscapeandmakingimageswandering
andgetting lost in ideas andinpictures. Althoughthiswork exploresthe subject of
nature,makingtheimageswas perhaps theonly "natural"thingaboutthe work.Though
thereweretherequisiteleaves, rocks anddirt,I eventually realizedthatnothing I
photographedwas really
"natural,"
but simplypropsfor my imagery.
Theexhibition dealtwiththeorganiclandscape fromtheperspective of one who had
neverreally leftthecity.Thework presents visual ideasof whatthe landscapemeantto
me and,hopefully,to others. Inthis paper, Iexplain theprocess ofmakingthework: the
ideasand referencesthatI cultivated whileworking,andmyvisual methods and
metaphors. I hopethatit gives someinsight intonotonly whatIwasthinkingaboutbut
alsohowthework progressed.
Growingup inan urban environment coloredmyview ofthelandscape. Cities, with
their neighborhoods, beachesand lakesweretome objects withtheirownindividuality
and character.Outofthe citywerethefarmer's market,summercamp, Santa'sVillage,
national parks,andtheme parks,whichdeveloped formethis notion oftheplace as an
object.Only
"nature"
asthe generic we callit,was a greener and lesspopulated object
than thecity orthe beach. Naturewas a placetowhich youhadto drive,a place where
themonotonyoftreesandsky was overshadowedbymosquitoes and thelackof urban
amenities.
Myearly education at aZionist grammar schoolinChicago, withits discussions
about a promised land(Israel) thatneeded mefor itsredemption, transformed the ideaof
theland-as-objectintotheland-as-idea. Inschool, Iwould watch movies aboutIsrael,
wherethepeople lookedlikemebut actedanddressed differently. Theyweredepicted
wearinggymclothes,pickingorangesfrom trees, carryingweapons and the
cinematography represented themwithinthis specific environment.
As goodZionistschoolchildren,we weretaughtabouttheimportanceofthisland.
Givingit assistance was a serious missiontobeembraced with pride. Ouractivities
included collecting money fortree planting,andI would propositionmy
parents' friends
forthis worthycause.Although I couldn'tquitegrasp atthatageitsimportance,I knew it
was amandatoryandsomehow beneficialcause.Now theideaoftheland-as-object was
expandedintothatof an objectthatwasdesigned andfundedby good people. Like any
"-VSf> :.,
.-.--: -5V --^--:
- -r"
..-I:
'
-.
;;^^>_ >^
. - -.;- --:--v":-.>i-v< r igsMB
"
IBBfc
}
constructioneffort was under way. Ironically,I discoveredyearslaterthat this ideawas
mostly correct.
Due tothese activities, naturehadcometorepresentsomethingthatone "did"
either
forrelaxation,asinvacation spots(Miami was also natureto meheatandhumidity,
and alargeexpansivesky providedtheatmosphere), shopping for betterproduce(the
farmer'smarketoutside ofChicago hadexcellentblueberries), ortolearnaboutthepast
(AmishAcresprovided ahistorical setting foractorsto dress up inperiod costumes and
re-enact scenesfromthepast).Aswell, my ideasof naturehad becomesynonymous with
arefuge; and onethatneeded usfor its defense.
Withtheseideasfermentingthroughout adolescence,I decided tomovetoIsraelat
theage of22 (after receiving myundergraduatedegree in New York City). I had, over
those years, learnedmore aboutIsraelandthelanguage ofitspeople. While Iunderstood
thatitwas similartoother placesin the world,I stillhad theidea thatIsraelwasthe
paradigm of
"nature,"
andthatbymovingthere Iwouldbecome more"natural".
I had mostly feltthatIsraelwouldbea good placeformeto developmyphotography,
away fromthefamiliarcities ofAmerica andina contextthatheld differentaesthetic
possibilities and problems.As aresult, most ofthephotographs Imade duringmy seven
yearstherecenter aroundtherelationshipofthenatural to theman-made.Thisis because
theurban areastherewerebuilt-upquickly and without much aesthetic consideration.
Theaccidentallookofthe streets andbuildingsofTel-Avivseemedtomimic aforestor
jungle whosedesignwas pragmatic and unconcerned withitsaesthetic appearance.
Unlike New YorkCityorChicago I feltasthoughIwasphotographinguntamed nature.
I could makesomething outofthis material,something otherthana mere representation
oftheobjectthatitwas.
The"natural" areas ofIsrael ontheotherhand,withtheir trees that I had helpedfund,
seemeddesignedand manicured. Theywereessentially, andliterally,parks.Thus, the
natural seemedman-made, andthe artificial seemed natural. Itthenbecame my task to
exploreand recordthe lookofthingsfromwithinthisframeof reference. In hindsight,
this startingpointwasinspired bymyownjourneyforself-understanding. My
"quest"
had beenalwaystofinda sense ofharmony between my environmentand myself. What I
had labeled"man-made" and
"natural"
essentiallymeant "me"
and"the
Universe."
My techniquewasinspiredbyreadings onTaoism andZenBuddhism. Ifeltthat the
way tomakephotographswasto deconstructtheconcepts and visionthatIhad been
taught, and attempt tobecomeunified withinmy surroundings. I feltthatif I could
-Ty
harmonywithmy environmentandultimatelywithinmyown mind. Iwasinspiredinthis
questbythe words oftheTao Te Ching:
Attainthe climaxofemptiness,
Preservethe utmost quiet:
Asmyriadthingsactinconcert,
Itherebyobservethereturn.
Thingsflourish,
Theneach returnstoitsroot.
Returning to therootiscalledstillness:
Stillness iscalled returntoLife,
Returnto life iscalledthe constant;
Knowingthe constantiscalled
Pre-Thesis Work
After arriving attheRochester InstituteofTechnologyforgraduate studiesin
PhotographyI continuedtoexplorea project I had begun in Israel: anexplorationofthe
twomostelemental organicsubjects, skies and sea. The images from my firstquarter's
review were small black-and-whiteimages oflandscapeelements,pairedincoupletsto
givean expressionofhuman interaction. The objectsthatI photographedwere meantto
representlarger opposing actionsalways at work: comingtogetherandsplittingapart,
entering andexiting, coveringandrevealing.This seemedtomethenatural progression
ofmywork: therhythmand essence ofthelandscape. Ineededtocontinue withthat
ritual ofmakingimages,thoughmyclassmates and professorsfelt differently.
Inthatfirstcritique,my finalproduct appeared toreviewersto betoofamiliar,too
straight-edgedand nostalgic. Landscape,Iwastold, was a"dead" subject thatheld little
interest forthecontemporaryartscene,whose concerns weredifferentand more specific.
Thecritique directedmeto a place whereIwasn'tcomfortable, where myabilities would
beputto the test.Yes,thefinalresults weretooderivative, yetI couldn't agreethat the
subject oflandscapewas trivial.Theappearance ofthelandand ourinteraction withitare
subjects worthyof aesthetic contemplation as well asbeingofhistorical importance.
There was one picturefromthefirstquarter's portfoliothatledmeto shiftmy
approachto thissubject.While photographing atthelakeoneday,Ihad become
frustratedthinkingabouteverythingthatwaswrongwithmy subject matterand,forthat
matter, my photographyoverall. Outofthisfrustration I beganthrowingrocksintothe
water, andto mysurpriseIthenbeganto see picturesintheconcentric ringsthatwere
made onthesurface ofthe still water,and made severalimages. In thefollowingweek's
critique,my classmateBrianEmerycommentedthat these images illustrated how forthe
firsttimeI had interactedwithmy subjectina physical way. Itwas an epiphanic moment
forme,whichledmeto realizethat thenext step in my photographicdevelopmentwasto
incorporatethemark ofmy ownhand intotheimagery.
My second quarter work revolvedheavilyaroundthisidea, and was a combination of
thephotographsI had beentakingandthe sketching I woulddo formyself. I had begun
touseAdobePhotoshoptomakeimagesthatmimickedthe process ofhand painting on
photographs,atechniqueI had learned from Jill EnfieldatParsons School ofDesign.
These digital images combined natural elements: branches, iceandshrubbery, withflat
colorfieldswhose purpose wasto hideanddisguisethenaturaland place themwithinthe
Lk
\
\h
-<N -
transformingit fromaphotographintoabstracted"painting."Objective formwas
flattened-out,andthe subject washeavilymanipulated.
As Iwas experimentingwiththeprocess ofcombining photographyand
drawingsomeimages appeared as
photographsbut wereinessencedrawn (as inthe
blue-printbranches), and someappearedasdrawings butwerein factphotographs(as in
theice).
ItappearedthatI wasattemptingtousetheseimagesashieroglyphs; theforms they
tookseemedtomimic crude drawingsof animals ortopography. Some looked asthough
painthad been scratched awaytorevealsomething hiddenand otherslookedasthough
theobjectwasbeing obscuredintentionally. The drawingswere primitive andtheir
strokeserratic;theymimickedtheappearance ofdoodles or sketches. I begantorealize
theconnectionbetween sketchinganddraftwriting; bothweretimelessmeans of
recording. I had feltthat something,as yetundefined,wasstarting tohappen.
IntheendI had founda method andtechnique,and perhaps made couple of good
images,yetthemessage seemed unclear.Atthattime, myprofessorElliott Rubenstein
toldmethatmy goal shouldbetofinda reasonfor combiningthismethod withmy
subject, therebycreatinga meansfortheirco-existence.
Ostensibly,mynew process was an experimentthatIafforded myselfinan attemptto
learn some ofthenew technology,and was urgedbymyprofessorstocontinue. Professor
Ostermanencouraged metofindaritual inthisprocessthathopefullywouldleadmeto
an enlightenedview,and subsequently tomore evolved work.Itwashissimple and
timelessadvicethatprovided methecomfort and confidence tocontinueinthese
uncharted waters. Professor Weiss hadasked meifwhatIwasmaking were photographs.
I toldhim thatI really didn'tknow,andhis reply wasthatitmightbe a goodideatofind
out. Though Ihadnoideaas towhathemeant,itsomehow stuck with me.
I was unsure wheretogo next. Ihadamethod, butwas uncertain asto howthat
should manifestitself intheimagery. Iknew thatI wantedto continue withthelandscape
as asubject, and sobegantocreate moreheavilymanufacturedscenerywith more
obvious manipulations.I continuedwiththe"cutout"
style as well asthe"drawing on
technique"
while also beginningtore-form objects themselves.
As Icontinuedtoevolvethis process, Icametounderstand thatwhatI had been
makingwere allegorical representations ofhowwe view thelandscape. Symbolically,it
representedourculturally manufactured method ofhow welookatthe land. The images
werean exploration oftheman-altered environment. Perhaps makingtheseimages from
r
a
wasbuilt-up byhuman handsandmachines, our means ofregarding itwasformedby
equally human ideas andmemories,televisionand other cultural media, stories and
heritage. Inotherwords, our visionis coloredbythemessagesthatsurround us. Mostof
all,Iwantedthese ideastobeas accessible astheland.
Itwasimportant formeto show howtheideaoflandscapesboth urban and
ruralhad become depersonalizedandhomogenous. Ourexpectations of what we see
becamewhat we see; theimages replacedthe worlditself. Picturesare sometimesbetter
than reality;they couldgive usthefeelingof experience withoutthe burdenof
experiencing it directly. Withtheseconcepts beginningto takeshapemythesiswork
"The RootsScroll"
14x188 inches
Inkjeton parchment paper
The Roots Scroll
The Roots Scroll isperhapsthe mostdirectvisual descendentofmy firstyear's work atRIT. Itcontainedtheaforementionedsubtractive(cut-out) processtodigitallyfuse photographyanddrawingwhilemakinga more overt statement aboutthesubject matter
anditsprecedentsinart.Throughthe process ofmakingthispicture(longhours of
careful"cutting"and"connecting" in AdobePhotoshop), my interests in Zen Buddhism
andTaoism becameevident. Inhindsight,theprocess ofmakingtheimagewas a
metaphorforthefinal image itselftherewas somethingthatIneededtounearthinorder
toadvance myselfto thenextlevel. Theprocess ofdigging awayattherootsI beganto
pairthepictures content withitslanguage; itshowed thepoints I hadwantedto express.
Thiswas quite a realizationforme;notonly infinding a new method ofmakingpictures,
but becausearmed withthisnew technique the correlation of subject and medium would combinetogivethepictures theirsignificance. Itappears now that throughProfessor Osterman'sadviseconcerningtheritual, I hadaddressedProfessor Rubenstein'sconcerns about syntaxconflictingwith subject matter.
Myprior educationin photography hadcentered on questions of subject matter and
itspresentation. Abandoningthis traditional approachdirectedmeto seethatdigital
representation allowed metocreatemy ownconceptuallandscapes. In theRootsScroll, I
placedthetree rootswithin a religious(torahscroll)contextinordertopresentitssubject as carryingspiritual weight.
To manyculturesofantiquity, a tree'sroots representedtheroots of our contact with
theGodhead. Trees have special significancein manyculturesfromtheneareast,
probably dueto theirrelative scarcity.Tree worship had becomecommon practicein whichthe tree was consideredtheabodeofthedeity. Offerings werelaid atthe tree's
baseand on its
branches.2
InAncientEgypt, severaltypes oftreesappearin mythology and art(althoughthehieroglyph signifyingthe treeappears tospecificallyrepresentthe
sycamore).Accordingto the BookoftheDead,twin sycamores stood attheeastern gate
ofheavenfromwhichthesun godRa emergedeach morning.TheGreek Godswere
traditionally bornatthefootof atree,andSiddhartha had gained perfect wisdom while
sittingunderthe bodhitree.
Yet, closestto myown culturalhistoryarethe treesoftheJewishtradition. The Kabalisticnotionbasesthecreationoftheworlduponthe ten sefiroth(aspects ofthe
creator).Thesesefiroth are writtenconcepts suchaslove, judgement, wisdom,will, etc.
They serve asthebackbone (theroots)of allthatismanifest, and areorganized uponthe
"cosmictree:"
the structurethatholds God'saspectsinplace.
"/ am the one who planted this tree for all the world to
delight in. With it Ispanned the all, calling it all,for all
depends on it, all emanatesfrom it, all need it, all gaze upon itand awaitit.From heresoulsflyforth in
joy."3
Within theRoots Scroll isahiddenlandscapetheunseen structure ofthenatural
world.JustastheUniversewas constructed upon conceptsinthekabalistic tradition, also
echoedinthe Christianbeliefs4,treeroots representtheconcept of a spherethatbinds us
toour past.Thistransforms theobjectinto a collective place.Words such as
"religious,"
"cultural," "ancestral,"
and"spiritual sect,"
followedbythe word"root(s)"evokeastrong
connotationof a pasttowhich we arehistorically connected. For mygeneration,
however, thisconcepthasalways been precariouslyperched.
Having grownup watching Sesame Streetontelevisioninstilled inus a poly-cultural
sense of respectforallpeoples,histories,and lifestyles. Weweretaught tosee ourselves
asfully autonomousbeings boundtoademocratic philosophy whichleveledall notions
of religion andbelongingto an equalplaying field. Ourculture anditsvariedreligions
were considered secondarytoour status as citizens. Ourreligion wasto becelebrated
with certainholiday ritualsthatweleft buriedaway,hiddenfrom daytodayview.Fora
televisionculturelikeminethisplan seemedtowork well.
Ourculturaliconswerebroughttousinthelanguageoftelevision.They gaveus,
figures such asCookie MonsterandBigBird, alongwiththegenerational motto The
MostImportantPersoninthe World is You. Whilethisphilosophy seems noble and
virtuous,itclashed withtherealitiesoftheAmericancultural landscapeofthe time: war
in Vietnam and economicinflation. Thenostalgic
"revival"
ofthe 1950sgrewfromthe
sense that thepast was abetterplace,where values such asfamilyand organized religion
were more deeply ingrainedintheindividual'spsyche.In 1970GaryMarshall createdthe
televisionshow HappyDays,in responseto this situation.Itfilledtheindividual's need
fora collective identityineffectitreplaced culture withhistory,and historypresented
in30-minutesegments waseasily consumed.Thus,
"Retro"
culturewasbornandthepast
was giventous as a virtual place of refuge.
Althoughretro culture was perhaps a new phenomenoninpopularmedia, thisconcept
wasalready well establishedin thearts. Idealized landscapesoftheBaroqueperiodused
historyand mythologyas subject matter and portrayedtheminArcadian5
surroundings.
Sceneswere stagedin dreamlike and poetic states.Characters were presented with
primitivetraitsandchildlike attitudes,self-engrossedlooksand contented poses. They
loungedaroundinan eternalspringtime offreelove. Thesimilaritiesbetween Arcadia
freedom from earthlyperil. Thekey difference lies inthatEdenwas a place tobe
someday regained andarcadia was a placethatwasforever lost. Ineithercase, the
presentheldpromisefordarkness,withthe Eden/Arcadia ideal forescape. Inthevisual arts,idealized landscapes "stage"
a scene whosebackgroundand
lighting suggestan attitude ofdeepnostalgia; alongingfor freedom fromsuffering.
Claude Lorrain'scompositionsare almostformulaic intheiruse ofdarkfoliageor rocks
onthesides oftheimage,leadingthe eyeto theclearlightandairy distance. The view
beingpresentediscleanerandtamerthan natureitself. Human figures inthecomposition
rangefrom smallto miniscule so astoelevate thesignificance ofthesetting from
atmosphereto subject.
Among thepresent-dayexamples ofthisUtopian aesthetic model,Trancemusic hasa
similar motive.Ittoo elevatesthemelody ofthemusic to the status of message and
almost eliminates thelyrics.Taking itscuesfromtheBeatles'returnfrom India inthe
late 1960s,Trancemusic uses eastern and primitive rhythms asits inspirationas was also
theimpetus for hippie fashion. Themembers ofTrancemusic culture adorn themselvesin
child-likeclothes, sometimeswearing pacifiers andcarrying stuffed animals. Itsforum,
theRave,is based ontheHappening motif,where largecongregationscelebrate overfull
moonweekends innatural settingsforoutdoordancing andindulgence in drugs. The
themesofPeace, Love, Unity, andRespect
(PLUR)6
arekeyconcepts toTrancers;
echoingpsychedelicculture whileaddingcontemporarypolitical correctness.
Moststrikingtome aboutthecurrent retro movementis how it is wholly lifted from
another era'scounterculture.The mainstreamingof retro cultureintoday'scommercial
market(showpic of ptcruiser) seemstorepresentastrong desiretoreturn to a simpler
wayoflife. Today'ssense of cultural vaguenessisbeingfedandfattenedbya general
apathyand a sensethat thefuture will notbesuch"Happy
Days."
In anycase, theRootsScroll is both homageto ourquestfor insightand admonition
of ourblindness. I wantedtopresenttherootsas amanuscriptdocument on parchment
papertomarktheresemblance in formto the structure of ancientand untranslatabletexts.
Creating anexample of
"authentica"
(something madeto lookfakeby symbolizingthe
realthing)which alsodrewfromtheZenandTaoistbooks Ihadread.
The jadedcynicismthat keptmefrom acceptingthereligious aspects ofthese
teachingswasenlightening. As I hadexpressed,Zen teachingswere philosophical
frameworks fromwhichI tried topracticetheartofphotography. Zenshowed me a
different wayofmaking sense of what can seemlike anillogical pursuit.Itwas a set of
beliefs,whichprovided acompassionateunderstanding of artmaking,whose purpose
thechannelingofideasand craftinto a productdevoidof extraneous information;e.g.,
strippingthe essential rootsfromtheirbackground.
A goal ofZen istofind any essence.In mycaseit isthe essenceofformandidea
alongwith aframeworkto cope withthepanic andlossofdaily life. I see nowthat
althoughthe tenetsofZenarehelpful and sometimesprofound, thesearchforessenceis a
hindrancetofindingit. The questforanideal is actuallyanti-Zen, yetthissame
pilgrimageis considered a virtueby our nostalgiccultureits
goal being thereturntoa
betterpast.Ifeel that this quest, whilecharming, isnihilisticandwhollyunproductive.
Theroots scrollis meanttospeaktoall of usin alanguageweinvented ourselves.
Shuryu Suzukisaid:
"Ifan artist becomes too idealistic, he will commitsuicide, because the gap between his ideal and his actual ability
there is a great gap. Because there is no bridge long
enoughto goacross the gap,hewillbegin todespair. That
is the usual spiritual way. But our spiritual way is not so
idealistic."7
"The Interconnected Branches InteriorMural"
The Interconnected Branches Interior Mural
WhiletheRoots Scrollwas meanttoserve as a symbol forone's nostalgic searchfor
anideal, the conditionsspawningthisphenomenonare representedintheInterconnected
Branches oftheinteriormural. Printedon wallpaper and pastedto the wall, this8x 10
foot image plays withthe viewer'srelationtohissurroundings. It has becomea popular
idea intheculture ofpostmodernism(thanks inpartto thephilosophyofKarlMarx) that
ourcontemporaryeconomic situationhasplayedalarge roleintheindividual's
conception ofthe self withinhisenvironment. Forexample, theadvent oftherailroad and
theautomobile engine created a world much smaller andfarmore accessiblethanit had
beenacentury before. The contemporary landscape is defined largelybythespeed in
which we passthroughit. In today'stechnologywithits high-speed Internetconnections
and variations ontelephony, we are ableto transcend spatial barriersas well astime
delay. Thistechnologyhas broughtto oureconomywider coverage andless dependence
upon physical presence.We are more concerned withthe changesoccurring inmarkets
outside our ownimmediacy. The phenomenon ofglobalization,followingthe
abandonment ofthe gold standard, instigatedthede-materializationof physicaldistance.
Thisphenomenon canbeseenin toady'sfloatingexchangerates where all currencies are
nowinterconnected. Likeitornot,industrializednationsareinthis together.
WhiletheideaoftheGlobal Villageis a clichein itsemphasisoncommunity, the
conditionsthatcreatedit greatlyaffecttheindividual.Our disconnectionfromplace
engineersanenvironmentlackingboththephysicalityandgrounding ofplace.Justasthe
lackofgravitycausesosteoporosisinastronauts,Globalismcreatesa universalized
societythathas little regardfortheprevious
generations'
centers of culture.This lackofa
central urbanlandscaperesultsinurbansprawl.Traffic,thelackofsidewalks, and gated
communitiesareallthe productsofthegloballandscapewhosephysical connections
create alackofsocial connection.
ThebranchesoftheMural lullthe viewerintoafalsesense of comfort. Iwas very
happytohearpeopletellmethatittook themupto30minutesofbeing aroundtheimage
to realizethat somethingwas
"wrong"
withit.Theyhadthoughtthis wassimplyapretty
picture oftreebranches againstthe sky, andthatitsgreataccomplishmentlayinthescale
and renditionofcolor,coupled withthenebulousideaofbeing"well
composed."
Whatappearedto beaworm's eye view ofthefloweringtreesofspringwas, infact,
acombination ofimages (40to 50)seamlesslycollagedtogether.Branches were
connectedin illogicalways, andspaceswerereconstructedtojartheviewer's sense of
rational perspective. Itwaseasyto inducethis response; I used myself as an example of
someone who has verylimitedexperienceswiththe
organic world,andtried togive
myselfjustenoughinformation torelate to
myownidea (or memory)ofhow ascenelike
this should appear. Oncethe original suggestionwasvisually inplace,Iwasfreetoalter
asmuch oftheimageasIwanted. Whenthe trickbegan torevealitself, Iwould either
backofffromor strengthentheparts oftheimage thatgavethe suggestionof normalcy.
Withthis imageinparticular,Iamchallengingthevieweron twowidely heldtruths:
first,ourbeliefthatphotographsaretruthful documentsoftherealworld,andsecondly, a
strongerandeven primordialbeliefthatthenaturalisauthentic.Addressingtheformer: a
photographis supposedlyatwo-dimensional depiction inlight,formand color of a scene
fromoneviewpoint. It iswhat wehave beenconditionedto see;it forms ourwayof
organizingthoughtsintoa cohesive and rational reality.Withregardto theauthenticity of
nature,our society'scurrentinterests inorganicfoodand naturalproducts,"eastern"
medicine, yoga,andrealitytelevisionindicate thatwe needtohavethebelief,if only in
appearance,that there aresome areas which shouldn'tfallto human intervention. There
isan almost religiousmentality thatnatureis recognizably distinct fromman-made
reality,andthatit ismorevaluable,as evidencedbytheexamples of organic apples and
free-rangepoultry. Cezannesaid almost 100 years agothatwhen we seetheland, all we
see are pictures.Personally, I have seenfarmore pictures ofland thanIhave seenthe
land itself.
Eachof ushas adesireto believethatwhatispicturedis real;averification of our
place withintheworld. Iwanted tomake animage thatacted as a metaphorforour
cultural
"placelessness"
andlackof grounding. Intheimages fromtheprevious year's
workIbegan tostrip away thebackground fromtheimage and slightlyaltertheformof
theorganic objecttoprovide afeelingofbeingremoved andhidden fromthe
environment.
TheBranches, morethananyother ofthese pictures, usedthetechnology ofAdobe
Photoshoptoform themessageoftheimage itself. Photoshopprovides an easy wayof
seamlessly montaging imagestogether.To connecttheroots I usedthesametechnique,
howeverastheobject was removedfromthe largerscene thespatial effects created by
this type ofmontageingwerelargelyhidden. This methodiscommon toPhotoshop,and
my interest lies in combining many separate points of viewintoone image.
Perspectivehas taken severalformsin its codification sinceitsrevolutionary
one-pointlinearperspective oftheRenaissance. Fromthecontinuationofthatcodificationin
photographytoCubism'srejectionofits conventions, thisnewtechnology enables us to
arrange several
"modern"
Linearperspective makes certain assumptions: namely thatimagesaredisplayedflat
on acommonplane, thatthe artist sawthe scenefrom afixed point of view with a
singularand objectiveeye,andthat there isa pre-determined point of view inwhichto
lookattheimage. AsPanofsky said:
Inasense,perspectivetransformspsychological space into
mathematicalspace.Itnegatesthedifferences between frontandback, betweenright andleft, between bodiesand
interveningspace
("empty"
space), sothat thesumofall
thepartsofspace and allitscontents are absorbedintoa single "quantum continuum."8
Whilethistypeof perspective makes thatoftheviewerthedeterminingfactorofreality,
thenew technologycan alsoplay withthisidea. Astheideaof cultural placelessness
affectstheindividual's sense ofdeterminingreality,IfoundthatintheInterconnected Branches Iwasillustratingthispointbygenerating a sceneinwhichtherearemany
points of view.
There isno one visual point of referencein whichtoseethepicture.The picturehas
illogicalforeshortening and an absurd sense that therules ofthenatural world have
somehowbeen broken. The large-scaleofthebranches fillsthe viewer'sfieldofvision,
as wouldthenatural scene,yetthe viewer cannotfindan anchor or reference. Seeing
several vanishingpointsconcurrentlyandhavingmultiple picture planesinspires a sense
of vertigothattheviewer must reconcile in hisownimagination. Becauseofthewealth
of similarimagestheviewersees, thisprocess of reconciliationis immediate; the
narrative ofthebranches is revealingofthe trick thathismind hasplayed uponitself. It
was aslight-of-hand gagthat turned thesubject ofthepicturefrombeingaboutthereality
of nature tobeingaboutthenature ofreality.
Myvisualinspiration forthistypeof picturelies inthelandscapescreen paintings
fromtheEdo periodinJapan. Screensare similartowallpaper murals intheirshared
historicalpurpose ofinteriordecoration, andas such aretotemsindicativeofthe
prevailing socialstructure.As theTokugawaShogunategainedpolitical control over
Japan inthe 17thCentury,the socio-culturalhierarchywentthoughdrasticchanges.A
society offeudal imperialistsperpetually at warbecame more unified andpeaceful; and
Japan's economyprospered.
Astheweight of war removed thestronghold ontheurban merchant class(alongwith
therapid growth oftheurbancenter; i.e., Edo-Tokyo),thereemerged a new set ofluxury
goods,popularart,design, andentertainment.A decadent culture arosein strongcontrast
to thepiousfeudal society thatpreceded it.Fashion, entertainment,brothels,and other
pleasures werethe new motifsexploredbyartistsintheirdepictions of society. The
conceptofUkiyo-E(floatingworlds) wasintroducedto describethefeelingsofthese
pleasures. Whilethereis astrongcorrelationtoKabuki (puppettheater)in thefloating
style ofUkiyo-E, the land itselfalsofloated. Hills,trees, and water were represented as
separate andautonomous elements disconnected from their surroundings,befitting the
carefree andpleasure-seekingphilosophy ofthe time(albeitcommissioned bythenew
government).
Thesimilaritiesare striking between EdoperiodJapanand ouryouthculture oftoday.
The popularityof cocaine inthe 1980s gaveway to thatofEcstasy(MDMA) inthe
1990s, and withitcame a culturethatwantedto beentranced andlost inmusic and
celebration. Inhis Tales oftheFloating World, Asai Ryoi says ofhistime
"..
.Livingonly forthe moment,turning ourfullattentionto
thepleasuresofthe moon, the snow, thecherry blossoms
andthemapletrees, singingsongs,drinkingwine, and
diverting ourselvesjust infloating, floating, caringnot a whitforpauperism staringusintheface,refusingtobe
disheartened, likea gourdfloatingalongwith theriver
current:thisiswhat we callthefloatingworld."9
Cyberspace today representsthe fleetingattitudethatmany ofmy generationpossess.
Itwould seemthatin both theglobalism oftodayandtheisolationismin Edoperiod
Japantheattitude ofapathy ispredominant. Whilefor EdoperiodJapanthepurpose of
thelandscape screens wastogive animpressionistic descriptionof"here I am,"
the
"The Mountain RangeBackdrop" or
"The GravelPiles"
28.5x140 inches(paneled)
The Mountain Range
Backdrop
Iused tolove westerntelevisionshows such asRawhide,KungFu, and The Lone
Ranger, alongwiththefilms ofJohn Wayne. I feltthatIshared theirsolitary spirit.I had
thatsameunderstandingofbeingalone,ofbeing"out
there"
asthey were. Maybeitwas
theinfluenceofDisco,whosethemewasdancing alone,or maybeIwasjusta
melancholy kidwho spenttoomuch timewatchingtelevision.In eithercase,I could
relate.Lookingbacknow,with theeyes of someone educatedinwesternlandscape
painting,I seethatStarTrek, Star Wars, andLostinSpacewere examiningsimilarideas
aboutthefrontieralbeit updatedfor contemporary times. Moreover,Ifeltthat theattitude
aphotographerhad to takewasthatof alone gunman,movingabout ahardroador
grassy knoll,on a questfor... something. I neverknewwhatthesecowboys werelooking
for,but I wastold thatitwasthequest alonethatmattered. Manyyears later, readingJack
Kerouac's OntheRoadconfirmedthevalidityofthisidea. Yearsafter that,whilehiking
inthe Sinaidesert, withBedouinand camelsreplacing Indiansandhorses I finallygot a
taste ofthewild and ruggedlandscape which theLone RangerandTontohad inhabited.
Myvision ofthatscene wasinfluencedbywhatI hadwatched 20years earlier on
television.
Thefinal incarnation oftheMountainRangeBackdropwas atribute to my
television-inspiredview oftheland. It began simply throughphotographingthose ubiquitous piles
of gravel thatseemto litterthe Rochesterarea. What I saw onthe contact sheets was
compellingfromthebeginning;the gravelhad beentransformedintohills, dunes,mini
mountains, androlling fields. Byaddingcolor, Icouldturn these scenesintoanyplace
imaginable. I learnedthen thatcolor equalstheme;and sincethemeinthiscase wastied
to setting,I could changethesetting bychangingthecolorsofthegravel. I thoughtof
the cowboy, who carriedthemyth ofthe wild, untamedland asabackdropfor his own
wild, untamed nature. Assuch,I became thepicture-makingcowboy.Clint Eastwood's
archetypal questin his various portrayals ofthecowboy wastomake thelandand notbe
subjected toit. I figured thatiftherewas no cowboy, thanno camera wouldbe
photographing himagainstthewestern backdrop.
There isareciprocalrelationship between wildness anddiscovery. Examplesforthis
ideaareabundant: the childrenofIsrael wanderedin theSinai before comingto their
promisedland,Jesusand other mystics went to thewilderness tobefore resolving problems, theAmericanIndians tookhallucinogens inreligious ceremoniesinorderto
communicatewithdivinebeings, and artistscontinue timelessly tograpple with"the wild
side"
beforeformalizingtheirideason canvas or on paper. Whileitwasthe western
wildernessofmountains,Indians, deserts,valleysand gorgesthatshapedtheAmerican
consciousness, itwasthrough thetamingofthefrontierthat the real Americanidentity
wasfounded. Thetopography ofthe west,despitebeinga place of peril andfear,was
also onethatofferedmany natural resourcesof greatbenefitto
burgeoningAmerican industries.
Toprovidethe readerwith abrief
backdrop
ofthe literaturethatinfluencedme, itwasnot untillaterthatnatureitselfbecameasource of pridetoAmericans. The footprintof
Europeancivilization uponthe"NewWorld"
transformedthiswildernessintoan
environment ofpossibility; a virtual GardenofEden. While themagnitude ofthe
landscape served as ametaphorforthe grand plansto the continent, italso served as a
metaphorforescapefromthe confinementofEuropeanoppressionleft behindby the
immigrants. In John O'Sullivan's article onManifestDestinyhepoints to thelandas a
place where a new society canbe built:
"Theexpansivefutureisourarena, andforourhistory. We
areenteringon its untroddenspace, withthe truthsof God
inourminds, beneficentobjectsinourhearts, and with a
clearconscienceunsulliedbythepast. Weare thenationof
humanprogress, and whowill, whatcan,setlimits toour
onward march?Providence iswith us,and noearthly
power can. Wepointto theeverlastingtruthon thefirst
pageofour nationaldeclaration, and we proclaimto the
millionsofotherlands, that 'thegatesof
hell'
thepowers
of aristocracyandmonarchyshall not prevail against u:"0
Transforming the wildernessinto a cultivatedlandscape meantembracing theWildas
a concept.This concept wasillustratedbypainters such asCole, Bierstadt,Church,and
Moran; and wasfundedby theUnitedStates Government. Thomas Moran,who had
worked asChief Illustrator for Scribner'smonthly,hadenough political pull to gain
accesstomost parts ofthe Westatwhichtimewas beinglobbied bycongress as national
park recreational landfortourismpurposes. Fundedby JayCooke,the Presidentofthe
Northern PacificRailroad,Moran set out onthe geologicalsurvey expedition of
Ferdinand Hayden in 1871. Whilethetripwas essentiallya public relations campaignto
fostermore curiosity innatural wonders such as theGrandCanyonandYellowstonefor
thebenefitofthe railroad,Moranin hiswork underscoredthis sense of wonder.His
paintingoftheGrandCanyon, boughtbythe UnitedStates Government for$10,000,was
"Iplace no value uponliteraltranscriptionsfromnature.
Mygeneral scopeisnotrealistic;allmytendenciesare
towardidealization. "
In Moran'spainting,alongwith thatofmanyothers, the myth of our national
character asAmericans is built. Onreview we can see how theseideaswere crafted: the
ideaofthemountainis symbolicfortheheightsconceivable bythehumanmindin its
questforsafety, security andentertainment.
The depiction of naturein alandscape isconnectedto theideaofownership;whether
thatnotionlies inphysical and political boundaries,likethoseoftheAmericanFrontier,
orthepossession ofthelandas setting for human drama. We usethelandanditsorganic
elementssymbolicallyto enrich our stories and create our myths.There is also,however,
abiological aspecttolandscape representation,which supposes an evolutionary
preferencefor landtobe "owned"
in some sense.
There have been scientifictheoriesstatingthatour visual preferencesforcertaintypes
oflandscape derive fromourevolutionary needs. Savannatheory (Habitattheory)
proposes an obvious conclusion thatour choice of environmentis dependantupon our
abilitywithin ittoforage for foodand seek shelterfromtheelements. Scientific studies
conductedin children(whosepreferences wouldsupposedlyreflectinstinctoverintellect)
onthe typesoflandscapestheypreferred showed aninclinationtowards landscapes
similarto those oftheAfrican Savanna (inwhichit is thought thatmuch ofearly human
evolutiontookplace).
Theaesthetic elements oftheAfrican Savanna include water, treeswithbranches
beginningtwometers offthe ground,avariety of woodedand clear areas(placestohide
and/orescape), and paths which comein and out ofview providing areas of
exploration.12
Whilethisattitudecanbe seeninpost-Renaissance landscape designof
parks and gardens,italsoholds truefor depictions offine-art landscape. The Russian
artistsKomarandMelamid conductedopinion pollstodetermine styles ofpainting
most-andleast-preferred byWesterncountries,andthefindingswere striking. Thevast
majority of countries preferredlandscapepaintings whose attributes mimicthoseofthe
Savannatheory polls: therepresentationof availablefood (animalsandplants), water,
shelter,andclarity of vision.
More strikingwasthepreferenceforthe depictive styleoflandscapesoftheHudson
River School. Inthese landscapesthereisalarge landmassin thedistantleft, abodyof waterin the middle, treesonthe right, and aclearing inthefront. Perspectivewas placed
highoffthe groundand withpredominantly blue
skies.13
Giventhisresearch andthe
mythology surroundingdifferenttypesoflandscapedepictions,alongwiththeinfluence
ofthetelevisedlandscape,it isno surprisethat theillusorylandscapeprevails inthe
Mountain Rangepicture. Itstatesvery clearlythatlandscapes are man-made phenomena and nevertruly "natural." Thispictureis forme themost successful ofthe seriesinthis
regard; theimagewascreatedbyphotographing landscapingmaterialsto builda
mountainmore convincingthanaphotographof a real mountain.Thelandscaping
material becametheimagebuildingmaterial.
I feel thatmy imagesconjureupnegativeideasabout man's relationto the organic;
anunderlyingthemeofdestructionandthemanipulationof a realmlongdeemed
untouchable contrastswiththebeautyand precious qualityofthesubject.The Wildlands
Project,EarthFirst, andGreenpeace are all noble causesforenvironmental protection,
espousingtheideathatwithout a natural wilderness our cultural sense of connectedness is lost. Their sometimesradical attempts at
"saving"
nature canbe seeninthe same heroic lightasthosepioneers whose drive itwasto "tame"it.
TheGaiatheory ofJames Lovelockpurportsthat theworldisalivingorganism, and
thatashuman beingswe are a part ofthatsystem.Yetmorethananyotherlife formon
Earth,wehave been abletochange and manipulatetheenvironment. It seemsthat the
natural process of adaptation and evolution arelawsreservedforthe other,
"lower"
life
forms.Seemingly,manhas defined himself inoppositiontonature as a defenseagainst
thepsychic crush ofhis inevitablyshortlife. Forexample, societiesthroughouthistory thatrespectedthe environmentfell to those thatdidnot.Thosesocietiesbycomparison weretechnologicallylessadvanced, theirpopulationspoor, andtheirattitudes we today haveranked as
"natural;"
whichtranslatesintomoreanimal, thanhuman. Itwas away forjustifyingnotonly the genocide oftheAmericanIndians, butalso ourantipathy for
theevents inthe underdevelopedportionsofthe world. Itisa product of ourfearof naturethatwe embarkupon a pathtore-create theworldforour consumption. It is
racism, and
"anti-nature."
In reality, we are mostpowerlessagainstthelawsof nature. Regardingourcrops,our picnics or ourwars
natural lawsmake thefinalanddispassionate decisionsforus. For pre-modern(pre-Renaissance)man,naturehadan entirelydifferentconnotation. Ideas such as picnics and walks intheforestwereanathematohis wayofthinking; hewas bound tonatureinthe same waywe areboundto our workplaces.Kenneth Clark,when
discussingmedievalman states:
"Theaverage layman would nothavethoughtitwrongto enjoy nature;hewouldsimplyhavesaidthatnature was notenjoyable. The fieldsmeantnothing but hardwork...
beyondthesemore orlessprofitable partsoftheearths
surface stretched an interminableareaofforestand
swamp."'4
Thefactorthatliberatesusfromourfearof natureisour newfrontier,technology.
Whetherinthe production ofcrops, thedomestication ofanimals,orthe harnessingof
naturalforcesandresources,technology hasgiven us given us a sense of power while
facingthesefears. It hassofar,despiteafewunfortunateaccidents, helpedus livelonger,
healthier lives. Ourtechnological innovations haveallowedustoinhabit everycornerof
theearth and exploititsresources, providing forus abackgroundinwhichwe canhave
an experience of nature while remaining comfortedbyourabilitytoleaveit.
Landscapehas becomean
"e-escape."
This ideaoftheorganichas rapidly evolved
alongwith our owntechnological evolution. Asthemallhasreplacedthetown market,
our relationto thevisible andtangible has beenaltered as well. The Mall hasmade our
physicallimitations of accesslessproblematic,bygiving us adesirefor increased
accessibility. Inthis turnhasprovidedforus aframework in whichtoview nature one
whichis optimized,sanitized andready forconsumption.
"Circular Rainbow InspirationalPoster"
18.5x24 inches
OffsetlithographyPoster
The Circular Rainbow Inspirational Poster
It is fairtosaythatfromtheir onset, depictions of naturehavealwaysbeensymbolic.
There isadriveto transform nature, whetherin
bioengineering
orinart. The earliest oflandscape motifsinmedievalartemployedtheorganic asrepresentations ofideas. Itwas
thoughtof as acarryoverfrom Hellenistictimes thatcognitiveabilitywasfarsuperiorto
sensory stimulation.In theJudeo-Christiantraditiontherainbow wasthefirst symbol; a
signfrom God toNoah afterthefloodthathewouldnotdestroy theearth andits
inhabitantsagain; itwas thecovenanthemade withtheearth. To manyother culturesthe
rainbow cametosymbolizethe ultimateharmonyoftheearth incontradistinctiontoa
great natural disasteror as abridge fromthe lowerto theupper worlds.The Buddhists
view therainbow asthe higheststate ofsamsarabeforetheclearlightofNirvanaas well
asrelatingtheseven colors ofthearcto theseven planets.
Ultimately, therainbow is a"bridge" betweenthenatural andthesupernatural, the
earthlyworld andthehigherworld, theworld ofsymbolizingour environment andthe
world of representation.Butwhathappenswhentheoptical puzzle, themystery behind
thephenomenonhas been discovered? Justas questions offreewill are re-examinedin
thefaceofDNAsequencing, the rainbow serves as anAtlantis: Itsnostalgic component
funnels it intotherealm ofkitsch. It has becomeafailed symbolinthefaceof ozone
depletionand globalwarming, carbon monoxidepollution, overcrowdingand a hostof
new diseases.
I madethe Circular Rainbowto symbolizethefailureofthemythic symbol,while on
theotherhand itrepresentsthenewfrontier. Ifthereis a pot of gold attheend of a
rainbow, a circularrainbowrepresentsour continued search.Technology haschanged our
conception ofreality intheway itprovidesforustheexperienceoflivingwithout
needingactual life. Tangiblenatureisno longerneededintheera of computer
simulation. Contemporarybiological researchis donepredominantlywiththeaid of gene
sequencing and chemical analysis.Thecomputerhasaided ourunderstanding ofthereal
as well as madeitobsolete.Thevirtual environmentis our nextfrontier,and perhaps it
willbetheonlyplaceinwhich we canlive our owncreationbecomingtoounnaturalto
sustainhumanity.
Makingthe Rainbow imageprovedfarmoredifficultthanI couldhave imagined. It
provedthatmakingsomethingappear simpleisextremelycomplex,involvinglotsof
complicatedstrugglingandmanipulating.Making somethingappear complex requiresthe
fluctuationsof one'shand. Thepicture wasmeanttoappeareffortlesswiththe simplicity
of a snapshot
somethingjust seenand recorded.
Circularrainbowsdohappennaturally; theyarevisiblefromairplanes.A classmate
of mine whohadwitnessedthison aflighttoldme aboutit, andI instantlythoughtthat
thisrepresentation would fitwith mycurrent themeofsentimentalandfabricated imagery
of nature.Acoupleofweekslater, I saw andphotographeda rainbow inthesky and
knewthatI had mysourcematerial. Tomakethepictureconvincing, theshape couldn't
be perfectlyround northe lightuniform.I hadto shapethe brightnessandthe saturation
oftherainbow withinthe sky,which alsohad its own undulationsofcolor,density,and
depth. An apparentlyclearskycontainsinfinite colors and values and a rainbowis part of
thatscheme.I canhonestly saythatI gained greathumilitythroughmakingthis picture,
recallingsome ofmy Taoistreadingsabouttheinterconnectednessofeventsthatboth
therainbow andtheblueofthe skyare neverisolated inform, butpart of atotality of
experience,linkingthe object withthebackground.
There was avery fine line between makingtheillusion appearconvincingly
"natural,"
andhavingit lookdigitallygenerated.There hadtobe imperfections inthe
circularityas well as afluctuation inthecoloringto createsomethingthatappeared real.
This challenge illustratedwhat Lao Tzu hadwritten millennia ago about"true
straightnessbeing
crooked."
Itseemedtomethat to sustainthefeelingof correctnessin
the appearance oftheimage, Ineededtopresenttheviewer withsomething incorrect.
There isan unconsciousleap offaiththatwe make whenlooking attheworld: it is
ourwayofrationalizing its inconsistencies, anditgives ustheillusion of normalcy.A
slightly imperfectcircle presents a catalystfortheviewertoimaginea perfect one. Ina
sense, thatiswhatthe rainbow symbolizes: we use anillusionto create anillusion. With
contemporary technologies,however, thedivisionbetween truth andillusion has become
highlyblurred. This isthe cybernetic notionof a circularcausality,createdtoprovide
machines with more efficientdatawithwhichtoact. Computers are machines withthe
abilityto "selfmonitor"
soasto becomemoreefficient,andina sense act(accordingto
theGaiatheory) as a self-sustained organism. Resolvingdatasystems withthenatural
systemisasteptowardsbecomingless dependantupondirecthumanperception.In
incorporatingcomputertechnology,wehaveplaced ourselvesintoa symbiotic
relationshipwith thevirtual: we control itanditcontrols us. PerhapstheY2Kfiascowas
ourfirstconcrete exampleofthisphenomenon.
The"space"
createdby theInternethasprovidedus with theabilitytocommunicate
andhaveexperiences withoutthe limitationsofmovingour physicalforms. Ifourfocus
in theadvancementof civilizationhasdependeduponknowledge,than the virtual
A
\lplatformpicksupthe pace withthespeed andaccessibility it has provided. Withoutthe
confines ofthe body,the mindis freeto observe andhaveadifferenttypeofinterface
withotherminds;more information ispassed morefreely.Combining thiswith
technologythat can actindependently, a newfrontier, orwilderness, is limited onlytothe
"OilonCanvas (engineoil onpavement)"
9x14.5 inches
Inkjet (iris print)oncanvas
Oil on Canvas
OilonCanvas is perhapsthe mostdifficult image to talk about; itwas themost
complicatedimagethatImade, and embodiesformethe sum ofthedystopicaspects of
ournatural world. Itwas madeinresponse to therainbow imageand was madein
referencetomyreadings ontheconcept ofthe Sublime.
I felta needin my thesisworktoprovide alargerpicture ofthe elements,which for
me representthenatural in ourtimes.I feltthathaving adisplay ofprettypicturesonly
gave part ofthe story. Ineededtomake animage thatwas in directoppositiontoall
other pieces I hadmade previously.I alsowantedto give myselftheopportunity toplay
with an edge with whichI feltuncomfortable.Thepurpose oftheotherimageswas to
relateinformation through pleasure, tolulltheviewerinto beliefordisbelief,and to
providefor hima platform wherehe couldfeelat easein viewing how I sawtheworld.
OilonCanvas attemptedtoremovethis platform and presentits ideas innakedform.
Likethe rainbow, OilonCanvas is anillusion: the colors we see are simple
refractions oflightonthesurface of an oil slickthatI found in aparking lot. Thecolor
couldonly be seenincertain parts oftheoil atanyone giventime,andto gain a picture
oftheentire object one hadtobemovingoverit. I wasdrawnto the shimmering surface.
Ithoughtabouthowtheobject was atthesametimebothnatural andman-made, and
wantedto representthis semi-miraculous, semi-banal objectinone picture. I createdit
byphotographing only theparts oftheoilthatreflected thelightmostintensely andlater,
withPhotoshop, seamingthosepartstogether. Iwas struckathowwhatI wasmaking
lookedlikepaint oil paint butthereal colorwas made upoflight. Itseemedto
embodypaintingandphotography, themoving image andthe still, thenatural andthe
man-made.Itwas at onceboth beautiful andterrifying.
The image is amorphousthe
opposing forcesthatholdtogetherourideasofformal
beauty. Readingaboutthe Sublime, I was struckbythe 19thCenturypainterJ.M.W.
Turnerandhispresentationofexperience;his sense ofdangerand excitement conveyed
to theviewer viahispaintings. Turner displayedtheincomprehensibleas a representation
of pure energy. I wasinspired bytheway in which thedepthofhis skies appearedto
proceedfrominfinitytowards thepictureplane, toeventuallyoverpowertheviewer.The
Sublimewasthat which, as opposed to beauty,calledintoquestion our notion of comfort
andsecurity inthevisible world. Imagerythat connotes,or conjuresup, thehelplessness
thatmanfeels inthefaceof great natural events(storms,darkness) callsintoquestionthe
essence of ourfreedomand autonomy. Butthesublime was also a romantic concept. It
came about as thecelebrationoftheindividualwithits pull away fromarationalist
<t*f*RF-mindset. Itshowed usthatwewere ontheedge oflargerdiscoveries, that thefear involvedneededto be,ifnotunderstood, deservingof attempted expression.
TheSublimeinart oftheromantic period was an eventthat tookplacethrough either
Nature's power or events ofhistoric myth.Itwashappening outsideof man's control and
placed inthehands oftheCreator. Itreferenced ourage ofdiscoveryandinvention,andit wasthought that true understandingofthepower ofthedeitywasto be found inthe
examinationof
"pure"
creation.Thoreauwrotein Walden in 1854:
"Godhimselfculminatesinthepresentmoment,and will
neverbemoredivineinthelapse ofalltheages.Andwe
are enabledtoapprehend at all whatissublime and noble
onlybytheperpetualinstillinganddrenchingofthereality thatsurrounds us."15
DuringWorld WarII,Americanartists oftheAbstract Expressionistperiod also
became interested in the sublime,yetforthem the reference wasentirely different. For
them thesublime connoted not anexternal,naturalfear,butan unknown ofgeography
and religiouspowerbutafearoftheinternal,
the unseeable,andtheseeds of man's
poweroverhimselfand others. As Freud'stheory oftheUnconscious hadpurportedthat there are areas ofthemindthatare at work without our cognitiveknowledge, and
Einstein'stheorieshadtoldusthatmass andenergywereinterchangeable,theparadigms
of our sense of self and placehad radicallyshifted. Theparadigm ofreality hadshifted
fromwhatThoreau hadmentioned, andthesublimein late Modernismexpressedthe
positionoftheviewer's mindbeyondthatofhis senses.
But how is it reallypossible todealwiththesublimetoday withoutfallingintothe
ridiculous?Ifthesublime assumes a soulfromwhich theindividual can experience"the
event,"
is itpossibletoreconcilethese"experiences" in lightof an existence wherethe
bodyandthe soulhavefallenout of contact?Socialconditionshave created anindividual
whose experiences arelargely virtualandtherealitythat surrounds usis largelyman
made.Thereare ofcourse new frontiers,new events and concerns which reachthelevel
ofbeingworthyof representation inthe Sublime intheromantic sensebut thatis for
theromanticsto workout.I had knownallalongthat theprospect ofcreatingthe Sublime
wasfutile; thatallIcoulddo isre-create and useits motifs.
Inshort,I hadmade asouvenir, a representationofthe"good old
days"
when nature
waspainted,andpaintingwasnatural
an image tohonorthelostera of creation withthe
fascinationwithbeingde-mystified,withthesuppositionofthe unknown andthetaming
of ourfears.
The Exhibition
BrianEmery andI decidedto combine our workto create atwo-manshow.About eight monthsbeforetheexhibitionwehad decidedtocombine our worktogether to createsomethingotherthanadisplayof pictures we wantedto presentourideas as a totalexperience and make a show thatjointlyexplored a singleidea.As bothour styles of workdealtwiththemanipulatedenvironment,wefeltthat the show neededtobecomean environmentin itselfthatwould mimic our collectiveidea.
Ouroriginal designsfortheshow were quite grandiose;its production wouldhave
beenhighlyexpensive and complicated. Forexample, thefirsttitlefortheshow was"A walkthough the city andintothe
garden."
Itwasintendedtomimic a museum exhibit where Brian'sstreet scene panoramas would beprintedlargerthanlifeanddisplayedin
cramped passagewaysthroughwhichthe viewerwould walk. Thecanvas would
physicallyencompassthe viewer; thus mimickingthefeelofstrolling down thecity
block.Mywork was tobepresented inan open space wheretheviewer would stand or sit at adistance ina relaxedenvironment,and could simply enjoythe scenery.We drewup some schematicsforthe show, designingthegallery space andchoreographingthe
viewers'
movements so as tocontinuewiththe themeof subtle manipulation. Whenour exhibition conceptbecamemorerealistic, we understoodthat the city/gardenideawas a muchlargerconceptthan thatwe weredealingwith.Takingall thisdowna notch we
begantounderstandthatBrianwaslooking atthe StreetandI was lookingatthePark. Mostofmy ideas begin thisway.They start with a muchlargerconcept of whatis
reallytherewhichfrees mymindtodreamof all ofits possibilities.Only later dothe
ideasget cleanedup andfileddown, presentingthereal idea ina morehonestanddirect format. Justasmypictures(liketheprocess ofphotographyitself) are subtractive,my
methodisto beginwiththelargeandrough, and workmy way downto thefine.
BrianandIwould spendtimebrainstormingonhow theconcept of our work needed tomanifestitselfphysically,butoncethefinal ideawasdecidedupon we would spend
longhours together,workinglate intothenightonthephysical pieces.Much of ourtime was spent atHomeDepot, making decisionsonthe types ofscrews,lightfixtures,paint colors and such neededtomounttheexhibition. Weworkedtogether, lookingover each other'simagesforcorrections, andoverseeingeach other's progress. I havenever worked
this waybefore;Ihadalways workedalone,andI cansay thatbeing insuch an
environmentalthough stressful was also extremelyhelpful. By having anotherperson
areasthatone of us was more skilledinthan the other, we were abletohelpone another
realizehis ideasmore quickly. Mostly,thebenefitofthiscollaboration washavinga
partner with bothanimpassionedand objective eye.
Conclusion
I wouldliketo quotefromthe exhibitionstatement, wh