• No results found

Portable Air Conditioner

N/A
N/A
Protected

Academic year: 2021

Share "Portable Air Conditioner"

Copied!
25
0
0

Loading.... (view fulltext now)

Full text

(1)

www.marsdelivers.com

Owner’s Manual &

Installation Manual

Portable Air Conditioner

PS-121D

(2)

2 Safety Precautions. ...

Safety Precautions

Installation Instructions

Operating Instructions

Maintenance

Table of Contents

Control Panel Features... Operation Instructions... Other features...

Safety Precautions... Air Filter Cleaning...

Troubleshooting Tips ... Unit Cleaning... Store the unit when not in use... Preparation... Design Notice...

Energy Rating Information ... Ambient Temperature Range For Unit Operating... Exhaust Hose Installation... Choosing The Right Location... Tools Needed... Accessories... Window Installation Kit... Installation...

Troubleshooting Tips

03 11 11 12 12 12 12 13 13 14 16 18 19 20 22 22 22 22 23

(3)

3

Safety

Precautions

Safety

Read Safety Precautions Before Operation and Installation

To prevent death or injury to the user or other people and property damage, the following instructions must be followed. Incorrect operation due to ignoring of instructions may cause death, harm or damage.

WARNING • • • • • • • • • • • • • •

Safety Precautions

WARNING CAUTION

This symbol indicates the possibility of property damage or serious consequences.

Installation must be performed according to the installation instructions. Improper installation can cause water leakage, electrical shock, or fire.

Use only the included accessories and parts, and specified tools for the installation. Using non-standard parts can cause water leakage, electrical shock, fire, and injury or property damage. Make sure that the outlet you are using is grounded and has the appropriate voltage.

The power cord is equipped with a three-prong grounding plug to protect against shock. Voltage information can be found on the nameplate of the unit.

Your unit must be used in a properly grounded wall receptacle. If the wall receptacle you intend to use is not adequately grounded or protected by a time delay fuse or circuit breaker (the fuse or circuit breaker needed is determined by the maximum current of the unit. The maximum current is indicated on the nameplate located on unit), have a qualified electrician install the proper receptacle.

Install the unit on a flat, sturdy surface. Failure to do so could result in damage or excessive noise and vibration.

The unit must be kept free from obstruction to ensure proper function and to mitigate safety hazards.

Do not modify the length of the power cord or use an extension cord to power the unit. Do not share a single outlet with other electrical appliances. Improper power supply can cause fire or electrical shock.

Do not install your air conditioner in a wet room such as a bathroom or laundry room. Too much exposure to water can cause electrical components to short circuit.

Do not install the unit in a location that may be exposed to combustible gas, as this could cause fire.

The unit has wheels to facilitate moving. Make sure not to use the wheels on thick carpet or to roll over objects, as these could cause tipping.

Do not operate a unit that has been dropped or damaged.

The appliance with electric heater shall have at least 3 feet space to the combustible materials.

Do not touch the unit with wet or damp hands or when barefoot.

If the air conditioner is knocked over during use, turn off the unit and unplug it from the main power supply immediately. Visually inspect the unit to ensure there is no damage. If you suspect the unit has been damaged, contact a technician or customer service for assistance.

This symbol indicates the possibility of personnel injury or loss of life.

(4)

4 •

• •

In a thunderstorm, the power must be cut off to avoid damage to the machine due to lightning. Your air conditioner should be used in such a way that it is protected from moisture.

e.g. condensation, splashed water, etc. Do not place or store your air conditioner where it can fall or be pulled into water or any other liquid. Unplug immediately if it occurs.

All wiring must be performed strictly in accordance with the wiring diagram located inside of the unit.

The unit's circuit board(PCB) is designed with a fuse to provide overcurrent protection. The specifications of the fuse are printed on the circuit board, such as: T 3.15A/250V, etc.

• • • • • • • • • • • • • • CAUTION

This appliance can be used by children aged from 8 years and above and person with reduced physical, sensory or mental capabilities or lack of experience and knowledge if they have been given supervision or instruction concerning use of the appliance in a safe way and understand the hazards involved. Children shall not play with the appliance. Cleaning and user maintenance shall not be made by children without supervision. (be applicable for the European Countries) This appliance is not intended for use by persons (including childern) with reduced physical, sensory or mental capabilities or lack of experience and knowledge, unless they have been given supervision or instruction concerning use of the appliance by a person responsible for their safety. Children should be supervised to ensure that they do not play with the appliance. Children must be supervised around the unit at all times.(be applicable for other countries except the European Countries )

If the supply power cord is damaged, it must be replaced by the manufacturer,its service agent or similarly qualified persons in order to avoid a hazard.

Prior to cleaning or other maintenance, the appliance must be disconnected from the supply mains. Do not remove any fixed covers. Never use this appliance if it is not working properly, or if it has been dropped or damaged.

Do not run power cord under carpeting. Do not cover power cord with throw rugs, runners, or similar coverings. Do not route power cord under furniture or appliances. Arrange power cord away from traffic area and where it will not be tripped over.

Do not operate unit with a damaged power cord, plug, power fuse or circuit breaker. Discard unit or return to an authorized service facility for examination and/or repair.

To reduce the risk of fire or electric shock, do not use this fan with any solid-state speed control device. The appliance shall be installed in accordance with national wiring regulations.

Contact the authorized service technician for repair or maintenance of this unit. Contact the authorized installer for installation of this unit.

Do not cover or obstruct the inlet or outlet grilles.

Do not use this product for functions other than those described in this instruction manual. Before cleaning, turn off the power and unplug the unit.

Disconnect the power if strange sounds, smell, or smoke comes from it.

Do not press the buttons on the control panel with anything other than your fingers. Do not operate or stop the unit by inserting or pulling out the power cord plug.

(5)

5

Safety

Precautions

Note about Fluorinated Gasses(Not applicable to the unit using R290 Refrigerant)

1. Fluorinated greenhouse gases are contained in hermetically sealed equipment. For specific information on the type, the amount and the CO2 equivalent in tons of the fluorinated greenhouse gas(on some models), please refer to the relevant label on the unit itself. 2. Installation, service, maintenance and repair of this unit must be performed by a certified

technician.

3. Product un-installation and recycling must be performed by a certified technician.

Do not use hazardous chemicals to clean or come into contact with the unit. Do not use the unit in the presence of flammable substances or vapor such as alcohol, insecticides, petrol,etc.

Always transport your air conditioner in a vertical position and stand on a stable, level surface during use.

Always contact a qualified person to carry out repairs. If the damaged power supply cord must be replaced with a new power supply cord obtained from the product manufacturer and not repaired.

Hold the plug by the head of the power plug when taking it out. Turn off the product when not in use.

WARNING for Using R32/R290 Refrigerant

Do not use means to accelerate the defrosting process or to clean, other than those recommended by the manufacturer.

The appliance shall be stored in a room without continuously operating ignition sources (for example: open flames, an operating gas appliance or an operating electric heater).

Do not pierce or burn.

Be aware that the refrigerants may not contain an odor.

Appliance should be installed, operated and stored in a room with a floor area according to the amount of refrigerant to be charged. For specific information on the type of gas and the amount, please refer to the relevant label on the unit itself. When there are differences between the label and the manual on the Min. room area description, the description on label shall prevail.

(6)

6

Compliance with national gas regulations shall be observed. Keep ventilation openings clear of obstruction.

The appliance shall be stored so as to prevent mechanical damage from occurring.

A warning that the appliance shall be stored in a well-ventilated area where the room size corresponds to the room area as specified for operation.

Any person who is involved with working on or breaking into a refrigerant circuit should hold a current valid certificate from an industry-accredited assessment authority, which authorizes their competence to handle refrigerants safely in accordance with an industry recognized assessment specification. Servicing shall only be performed as recommended by the equipment manufacturer. Maintenance and repair requiring the assistance of other skilled personnel shall be carried out under the supervision of the person competent in the use of flammable refrigerants.

Please follow the instructions carefully to handle, install, clear, and service the air conditioner to avoid any damage or hazard. Flammable Refrigerant R32 is used within the air conditioner. When

maintaining or disposing of the air conditioner, the refrigerant (R32) shall be recovered properly, shall not discharge into the air directly.

No open fire or device like switch which may generate a spark/arcing shall be around the air conditioner to avoid causing ignition of the flammable refrigerant used.

Please follow the instructions carefully to store or maintain the air conditioner to prevent mechanical damage from occurring.

Flammable refrigerant -R32 is used in the air conditioner. Please follow the instructions carefully to avoid any hazard. For specific information on the type of gas and the amount, please see the relevant label on the unit itself.

(7)

7

Safety

Precautions

1.Transport of equipment containing flammable refrigerants: See transport regulations.

2.Marking of equipment using signs: See local regulations.

3.Disposal of equipment using flammable refrigerants: See national regulations.

4.Storage of equipment/appliances:

The storage of equipment should be in accordance with the manufacturer's instructions. 5.Storage of packed (unsold) equipment:

Storage package protection should be constructed such that mechanical damage to the equipment inside the package will not cause a leak of the refrigerant charge. The maximum number of pieces of equipment permitted to be stored together will be determined by local regulations.

6.Information on servicing: 1)Checks to the area:

Prior to beginning work on systems containing flammable refrigerants, safety checks are necessary to ensure that the risk of ignition is minimized. For repair to the refrigerating system, the following precautions shall be complied with prior to conducting work on the system.

2)Work procedure:

Work shall be undertaken under a controlled procedure so as to minimize the risk of a flammable gas orvapor being present while the work is being performed.

3)General work area:

All maintenance staff and others working in the local area shall be instructed on the nature of work being carried out. Work in confined spaces shall be avoided. The area around the workspace shall be sectioned off. Ensure that the conditions within the area have been made safe by control of flammable material.

4)Checking for presence of refrigerant:

Explanation of symbols displayed on the unit(For the unit adopts R32 Refrigerant only): WARNING

CAUTION CAUTION CAUTION

This symbol shows that this appliance used a flammable refrigerant. If the refrigerant is leaked and exposed to an external ignition source, there is a risk of fire.

This symbol shows that the operation manual should be read carefully.

This symbol shows that service personnel should be handling this equipment with reference to the installation manual.

This symbol shows that information is available such as the operating manual or installation manual.

Caution: Risk of fire/ flammable materials (Required for R32 units only)

(8)

8

7.Repairs to sealed components:

1)During repairs to sealed components, all electrical supplies shall be disconnected from the equipment The area shall be checked with an appropriate refrigerant detector prior to and during work, to ensure the technician is aware of potentially flammable atmospheres. Ensure that the leak detection

equipment being used is suitable for use with flammable refrigerants, i.e. non-sparking, adequately sealed or intrinsically safe.

5)Presence of fire extinguisher:

If any hot work is to be conducted on the refrigeration equipment or any associated parts, appropriatefire extinguishing equipment shall be available to hand. Have a dry powder or CO2 fire extinguisheradjacent to the charging area.

6)No ignition sources:

No person carrying out work in relation to a refrigeration system which involves exposing any pipe work that contains or has contained flammable refrigerant shall use any sources of ignition in such a manner that it may lead to the risk of fire or explosion. All possible ignition sources, including cigarette smoking, should be kept sufficiently far away from the site of installation, repairing, removing and disposal, during which flammable refrigerant can possibly be released to the surrounding space. Prior to work taking place, the area around the equipment is to be surveyed to make sure that there are no flammable hazards or ignition risks. No Smoking signs shall be displayed.

7)Ventilated area:

Ensure that the area is in the open or that it is adequately ventilated before breaking into the system or conducting any hot work. A degree of ventilation shall continue during the period that the work is carried out. The ventilation should safely disperse any released refrigerant and preferably expel it externally into the atmosphere.

8)Checks to the refrigeration equipment:

Where electrical components are being changed, they shall be fit for the purpose and to the correct specification. At all times the manufacturer's maintenance and service guidelines shall be followed. If in doubt consult the manufacturer's technical department for assistance. The following checks shall be applied to installations using flammable refrigerants:

The charge size is in accordance with the room size within which the refrigerant containing parts are installed;

The ventilation machinery and outlets are operating adequately and are not obstructed;

If an indirect refrigerating circuit is being used, the secondary circuit shall be checked for the presenceof refrigerant; Marking on the equipment continues to be visible and legible. Markings and signs thatare illegible shall be corrected;

Refrigeration pipe or components are installed in a position where they are unlikely to be exposed to any substance which may corrode refrigerant containing components, unless the components are constructed of materials which are inherently resistant to being corroded or are suitably protected against being so corroded.

9)Checks to electrical devices:

Repair and maintenance to electrical components shall include initial safety checks and component inspection procedures. If a fault exists that could compromise safety, then no electrical supply shall be connected to the circuit until it is satisfactorily dealt with. If the fault cannot be corrected immediatelybut it is necessary to continue operation, an adequate temporary solution shall be used. This shall bereported to the owner of the equipment so all parties are advised.

Initial safety checks shall include:

That capacitors are discharged: this shall be done in a safe manner to avoid possibility of sparking; That there no live electrical components and wiring are exposed while charging, recovering or purging the system; That there is continuity of earth bonding.

(9)

9

Safety

Precautions

8. Repair to intrinsically safe components:

Do not apply any permanent inductive or capacitance loads to the circuit without ensuring that this will not exceed the permissible voltage and current permitted for the equipment in use. Intrinsically safe components are the only types that can be worked on while live in the presence of a flammable atmosphere. The test apparatus shall be at the correct rating. Replace components only with parts specified by the manufacturer. Other parts may result in the ignition of refrigerant in the atmosphere from a leak.

9. Cabling:

Check that cabling will not be subject to wear, corrosion, excessive pressure, vibration, sharp edges or any other adverse environmental effects. The check shall also take into account the effects of aging or continual vibration from sources such as compressors or fans.

10. Detection of flammable refrigerants:

Under no circumstances shall potential sources of ignition be used in the searching for or detection of refrigerant leaks. A halide torch (or any other detector using a naked flame) shall not be used. 11. Leak detection methods:

The following leak detection methods are deemed acceptable for systems containing flammable refrigerants. Electronic leak detectors shall be used to detect flammable refrigerants, but the sensitivity may not be adequate, or may need re-calibration. (Detection equipment shall be calibrated in a

refrigerant-free area.) Ensure that the detector is not a potential source of ignition and is suitable forthe refrigerant used. Leak detection equipment shall be set at a percentage of the LFL of the refrigerant and shall be calibrated to the refrigerant employed and the appropriate percentage of gas (25 %maximum) is confirmed. Leak detection fluids are suitable for use with most refrigerants but the use ofdetergents containing chlorine shall be avoided as the chlorine may react with the refrigerant andcorrode the copper pipe-work. If a leak is suspected, all naked flames shall be removed/ extinguished.If a leakage of refrigerant is found which requires brazing, all of the refrigerant shall be recovered fromthe system, or isolated (by means of shut off valves) in a part of the system remote from the leak.Oxygen free nitrogen (OFN) shall then be purged through the system both before and during thebrazing process.

12. Removal and evacuation:

When breaking into the refrigerant circuit to make repairs or for any other purpose conventional procedures shall be used. However, it is important that best practice is followed since flammability is a consideration. The following procedure shall be adhered to:

Remove refrigerant; Purge the circuit with inert gas; Evacuate; Purge again with inert gas; Open the circuit by cutting or brazing.

The refrigerant charge shall be recovered into the correct recovery cylinders. The system shall be flushed with OFN to render the unit safe. This process may need to be repeated several times. Compressed air or being worked upon prior to any removal of sealed covers, etc. If it is absolutely necessary to have an electrical supply to equipment during servicing, then a permanently operating form of leak detection shall be located at the most critical point to warn of a potentially hazardous situation.

2)Particular attention shall be paid to the following to ensure that by working on electrical components, the casing is not altered in such a way that the level of protection is affected. This shall include damage to cables, excessive number of connections, terminals not made to original specification, damage to seals, incorrect fitting of glands, etc. Ensure that apparatus is mounted securely. Ensure that seals or sealing materials have not degraded such that they no longer serve the purpose of preventing the ingress of flammable atmospheres. Replacement parts shall be in accordance with the manufacturer's specifications.

NOTE: The use of silicon sealant may inhibit the effectiveness of some types of leak detection equipment. Intrinsically safe components do not have to be isolated prior to working on them.

(10)

10 Page 10

15.Labeling:

Equipment shall be labeled stating that it has been de-commissioned and emptied of refrigerant. The label shall be dated and signed. Ensure that there are labels on the equipment stating the equipment contains flammable refrigerant.

16.Recovery:

When removing refrigerant from a system, either for servicing or decommissioning, it is recommended good practice that all refrigerants are removed safely. When transferring refrigerant into cylinders, ensure that only appropriate refrigerant recovery cylinders are employed. Ensure that the correct number of cylinders for holding the total system charge is available. All cylinders to be used are designated for the recovered refrigerant and labeled for that refrigerant (i.e. special cylinders for the recovery of refrigerant). Cylinders shall be complete with pressure relief valve and associated shut-off valves in good working order. Empty recovery cylinders are evacuated and, if possible, cooled before 13.Charging procedures:

In addition to conventional charging procedures, the following requirements shall be followed. Ensure that contamination of different refrigerants does not occur when using charging equipment. Hoses or lines shall be as short as possible to minimize the amount of refrigerant contained in them.

Cylinders shall be kept upright.

Ensure that the refrigeration system is earthed prior to charging the system with refrigerant. Label the system when charging is complete (if not already).

Extreme care shall be taken not to overfill the refrigeration system. Prior to recharging the system it shall be pressure tested with OFN. The system shall be leak tested on completion of charging but prior to commissioning. A follow up leak test shall be carried out prior to leaving the site.

14.Decommissioning:

Before carrying out this procedure, it is essential that the technician is completely familiar with the equipment and all its detail. It is recommended good practice that all refrigerants are recovered safely. Prior to the task being carried out, an oil and refrigerant sample shall be taken in case analysis is required prior to re-use of reclaimed refrigerant. It is essential that electrical power is available before the task is commenced.

15.Become familiar with the equipment and its operation. b) Isolate system electrically. c) Before attempting the procedure ensure that: Mechanical handling equipment is available, if required, for handling refrigerant cylinders;All personal protective equipment is available and being used correctly; The recovery process is supervised at all times by a competent person; Recovery equipment and cylinders conform to the appropriate standards. d) Pump down refrigerant system, if possible. e) If a vacuum is not possible, make a manifold so that refrigerant can be removed from various parts of the system. f) Make sure that cylinder is situated on the scales before recovery takes place. g) Start the recovery machine and operate in accordance with manufacturer's instructions. h) Do not overfill cylinders. (No more than 80 % volume liquid charge). i) Do not exceed the maximum working pressure of thecylinder, even temporarily. j) When the cylinders have been filled correctly and the process completed, make sure that the cylinders and the equipment are removed from site promptly and all isolation valves on the equipment are closed off. k) Recovered refrigerant shall not be charged into another refrigeration system unless it has been cleaned and checked.

oxygen shall not be used for this task. Flushing shall be achieved by breaking the vacuum in the system with OFN and continuing to fill until the working pressure is achieved, then venting to atmosphere, and finally pulling down to a vacuum. This process shall be repeated until no refrigerant is within the system. When the final OFN charge is used, the system shall be vented down to atmospheric pressure to enable work to take place. This operation is absolutely vital if brazing operations on the pipe-work are to take place. Ensure that the outlet for the vacuum pump is not close to any ignition sources and there is ventilation available.

(11)

11

Installation

Instructions

recovery occurs. The recovery equipment shall be in good working order with a set of instructions concerning the equipment that is at hand and shall be suitable for the recovery of flammable refrigerants. In addition, a set of calibrated weighing scales shall be available and in good working order. Hoses shall be complete with leak-free disconnect couplings and in good condition. Before using the recovery machine, check that it is in satisfactory working order, has been properly maintained and that any associated electrical components are sealed to prevent ignition in the event of a refrigerant release. Consult manufacturer if in doubt. The recovered refrigerant shall be returned to the refrigerant supplier in the correct recovery cylinder, and the relevant Waste Transfer Note arranged. Do not mix refrigerants in recovery units and especially not in cylinders. If compressors or compressor oils are to be removed, ensure that they have been evacuated to an acceptable level to make certain that flammable refrigerant does not remain within the lubricant. The evacuation process shall be carried out prior to returning the compressor to the suppliers. Only electric heating to the compressor body shall be employed to

accelerate this process. When oil is drained from a system, it shall be carried out safely.

Installation Instructions

Preparation

NOTE:

All the illustrations in the manual are for explanation purpose only. Your machine may be slightly different. The actual shape shall prevail. The unit can be controlled by the unit control panel alone or with the remote controller. This manual does not include Remote Controller Operations, see the <<Remote Controller Instruction>> packed with the unit for details.

Design Notice

In order to ensure the optimal performance of our products, the design specifications of the unit and remote control are subject to change without prior notice.

front

control panel

handle (both sides) horizontal louver blade (swing automatically)

Caster Panel

air outlet lower air filter lower air intake drain outlet

power cord buckle

bottom tray drain outlet power cord outlet

MODEL C rear upper air filter

(12)

12

Page 12

Installation

Instructions

MODE Temperature Range MODE Temperature Range

Ambient Temperature Range For Unit Operating

Cool 62-95°F

Dry

Heat(pump heat mode) Heat(electrical heat mode) 55-95°F

41-86°F

Exhaust Hose Installation

The exhaust hose and adapter must be installed or removed in accordance with the usage mode. For COOL,HEAT(heat pump type) or AUTO mode exhaust hose must be installed. For FAN, DRY or HEAT(electrical heat type) mode exhaust hose must be removed.

86°F

Choosing The Right Location

Recommend Installation

Your installation location should meet the following requirements:

-Make sure that you install your unit on an even surface to minimize noise and vibration.

-The unit must be installed near a grounded plug, and the Collection Tray Drain (found on the back of the unit) must be accessible.

-The unit should be located at least 12” from the nearest wall to ensureproper air conditioning. The horizontal louver blade should be at least 19.7” away from obstacles.

-DO NOT cover the Intakes, Outlets or Remote Signal Receptor of the unit, as this could cause damage to the unit.

50cm 19.7 inch 30cm 30cm 12inch 12inch 50cm 19.7inch

Energy Rating Information

How to Stay Cool with a New Portable Air Conditioner(For the models comply with the

requirements of Department Of Energy in US)

Because of a new federal test procedure for Portable Air Conditioners, you may notice that the cooling capacity claims on portable air conditioner packaging are significantly lower than that of models produced prior to 2017. This is due to changes in the test procedure, not to the portable air conditioners themselves.

The energy rating and noise information for this unit is based on the standard installation using an un-extended exhaust duct (Diameter: 6 in., Length: 60 in.) without window slider adapter or wall exhaust adapter A.

The unit with 10 feet extended exhaust duct is running by using 2 exhaust ducts (Diameter: 6 in., Length: 60 in. + Diameter: 6 in., Length: 60 in.). The Energy rating and noise information for unit with 10 feet extended exhaust duct is not assessed. (For some models)

NOTE:We recommend that operating the unit at room temperature below 95°F . Since there is a risk that the unit with 10 feet extended exhaust duct would not work at room temperature above 95°F under some extreme conditions, such as the lower air intake be blocked for 50%.

(13)

13  

Tools Needed

-Medium Philips screwdriver; -Tape measure or ruler; -Knife or scissors; -Saw (On some models, to shorten window adaptor for narrow windows)

Installation

Instructions

Accessories

North America

Name of Accessories MODEL AQty.

Shape Shape Name of Accessories Qty.

1 pc Window Slider A Bolt 1 pc 1 set Unit Adaptor

Security Bracket and 2 Screws 1 pc 1 pc Exhaust Hose Drain Hose 1 pc 1 pc Window Slider Adaptor(*)

Power Cord Buckle

ON/OFF

TEMP

SHORT CUTTIMER ONTIMER OFF MODEFANSLEEP

SWING

LED

1 set(*) 1 pc(*)

Window Slider B Remote Controller and Battery

(only for remote control models)

2 pc/4 pc(*)

1 pc/2 pc(*)

Foam Seal A (Adhesive)

2 pc Foam Seal B (Adhesive)

1 pc/2 pc/3 pc(*) Foam Seal C (Non-adhesive)

1 pc(*) Drain Hose Adaptor

(only for heat pump mode)

NOTE: Items with (*) are on some models. Slight variations in design may occur. What should I look for first when purchasing a portable air conditioner?

The right air conditioner helps you cool a room efficiently. An undersized unit won't cool adequately while one that's too large will not remove enough humidity, leaving the air feeling damp. To find the proper air conditioner, determine the square footage of the room you want to cool by

multiplying the room length by its width. You also need to know the air conditioner's BTU (British Thermal Unit) rating, which indicates the amount of heat it can remove from a room. A higher

Why is the cooling capacity lower on newer models than on older units?

number means more cooling power for a larger room. (Be sure you are comparing only newer models to each other- older models may appear to have a higher capacity, but are actually the same). Be sure to “size up” if your portable air conditioner will be placed in a very sunny room, in a kitchen, or in a room with high ceilings. After you’ve found the right cooling capacity or your room, you can look at other features.

Federal regulations require manufacturers to calculate cooling capacity based on a specific test procedure, which was changed just this year. Models manufactured before 2017 were tested under a different procedure and cooling capacity is measured differently than in prior years’models. So, while the BTUs may be lower, the actual cooling capacity of the air conditioners has not changed. What is SACC ?

SACC is the representative value of Seasonally Adjusted Cooling Capacity, in Btu/h, as determined in accordance with the DOE test procedure at title 10 Code of Federal Regulations (CFR) 430, subpart B, appendix CC and applicable sampling plans.

(14)

14

Page 14

Installation

Instructions

Window Installation Kit

Unit adaptor Exhaust hose

Window slider adaptor

Type window installation:

Press the exhaust hose into the window slider adaptorand unit adaptor, clamp automatically by elastic buckles of the adaptors.

Step One: Preparing the Exhaust Hose assembly Other Regions

Name of Accessories Qty.

Shape Shape Name of Accessories Qty.

1 pc(*)

Window Slider A Bolt

1 pc 1 set(*)

Unit Adaptor Security Bracket and 2 Screws

1 pc 1 pc

Exhaust Hose Drain Hose

1 pc(*) 1 pc

Window Slider Adaptor Power Cord Buckle

ON/OFF

TEMP

SHORT

CUTTIMER ONTIMER OFF MODEFAN SLEEP

SWING

LED

1 set(*) 1 pc(*)

Window Slider B Remote Controller and Battery

(only for remote control models) 2 pc(*)

Foam Seal A (Adhesive)

2 pc(*) Foam Seal B (Adhesive)

4 set(*) Screw and anchor

(only for wall installation models) 1 pc(*)

Foam Seal C (Non-adhesive)

1 pc(*) Drain Hose Adaptor

(only for heat pump mode)

1 pc(*)

(15)

15

Page 15

Installation

Instructions

Hook Hole Seat

Lower groove

adaptor Make sure the adaptor is inserted into the lower groove of the air outlet.

Step Two: Install the Exhaust hose assembly to the unit

Insert unit adaptor of the Exhaust hose assembly into the lower groove of the air outlet of the unit while the hook of the adaptor is aligned with the hole seat of the air outlet and slide down the Exhaust hose assembly along the arrow direction for installation.

Step Three: Preparing the Adjustable Window Slider Window slider A MODEL A Window slider B Bolt 1. 2.

Choose the window sliders according to the size ofyour window. Sometimes, it needs to be cut shortto meet the window size, please take extra care tocut it properly.

Use bolts to fasten the window sliders once they are adjusted to the Proper length.

(16)

16 Page 16 Installation Instructions Or Or Window slider AWindow slider B(if required)

Foam seal C (Non-adhesive type)

Installation

NOTE: Once the Exhaust Hose assembly and Adjustable Window Slider are prepared, choose from one of the following two installation methods.

Type 1: Hung Window or Sliding Window Installation(For some models)

1. Cut the adhesive foam seal A and B strips to the proper lengths, and attach them to the window sash and frame as shown.

2. Insert the window slider assembly into the window opening. Or Foam seal B (Adhesive type-shorter) Foam seal A (Adhesive type) Foam seal B (Adhesive type-shorter) Foam seal A (Adhesive type) Window slider A Window slider B (if required) Foam seal C (Non-adhesive type) Or 2 Screws Security Bracket

3. Cut the non-adhesive foam seal C strip to match the width(or height) of the window. Insert the seal between the glass and the window frame to prevent air and insects from getting into the room.

4. If desired, install the security bracket with 2 screws as shown. 2 Screws

Security Bracket

(17)

17

Installation

Instructions

5. Insert the window slider adaptor into the hole of the window slider.

NOTE: To ensure proper function, DO NOT overextend around the air outlet of the exhaust hose (in the range

or bend the hose. Make sure that there is no obstacle of 20 in.) in order to the exhaust system works properly. All the illustrations in this manual are for explanation purpose only. Your air conditioner may be slightly different. The actual shape shall prevail.

(18)

18

Page 18

Operating Instructions

Control Panel Features

NOTE: The following control panels are for explanation purpose only. The control panel of the unit you

purchased may be slightly different according to the models. Your machine may not contain some indicators or buttons. The actual shape shall prevail.

Indicator Function Indicator Function

HIGH fan speed light

AUTO fan speed light(all illuminate/all dark) MED fan speed light

LOW fan speed light

ION light SLEEP light

Degrees Celsius

LED display COOL mode light

FAN mode light DRY mode light

AUTO mode light

Degrees Fahrenheit Timer on light; Timer off light;

Heat mode light;

Power management light Power light

Operating

Instructions

NOTE: On some models is instead of °F. On some models (power light) is instead of (WIRELESS light).

FOLLOW ME light Wireless light

within 8 minutes, the unit will exit Wireless connection mode automatically and the

Wireless indicator illuminates. If connection has failed within 8 minutes, the unit exits Wireless connection mode automatically. After Wireless connection is successful, you can press and hold SWING and DOWN (-) buttons at the same time for 3 seconds to turn off Wireless function and the LED DISPLAY shows 'OF' for 3 seconds, press SWING and UP(+) buttons at the same Swing/Wireless (On some models) button

Used to initiate the Auto swing feature. When the operation is ON, pressing the SWING button can stop the louver at the desired angle.

Used to initiate the Wireless function. For the first time using the Wireless function, press and hold the swing button for 3 seconds to initiate the Wireless connection mode. The LED DISPLAY shows 'AP' to indicate you can set Wireless connection. If connection(router) is successful

CONSTANT FAN(Press 3s)

CONSTANT FAN(Press 3s)

CONSTANT FAN(Press 3s) CONSTANT FAN(Press 3s)

(19)

19 Page 19

Operation Instructions

Operating

Instructions

time to turn on Wireless function and the LED DISPLAY shows 'ON' for 3 seconds.

NOTE: When you restart the Wireless function, it may take a period of time to connect to the network automatically.

Timer button

Used to initiate the AUTO ON start time and AUTO OFF stop time program, in conjuction with the + & - buttons. The timer on/off indicator light illuminates under the timer on/ off settings.

Mode button

Selects the appropriate operating mode. Each time you press the button, a mode is selected in a sequence that goes from AUTO), COOL, DRY, FAN and HEAT (cooling only models without). The mode indicator light illuminates under the different mode settings.

Up (+) and Down (-) buttons

Used to adjust (increasing/decreasing)

temperature settings in 1°F (or 2 °F) increments in a range of 62°F to 86°F (or 88°F) or the TIMER setting in a range of 0~24hrs.

NOTE: The control is capable of displaying temperature in degrees Fahrenheit or degrees Celsius. To convert from one to the other, press and hold the Up and Down buttons at the same time for 3 seconds.

Fan/Constant fan(On some models) button Control the fan speed. Press to select the fan speed in four steps-LOW, MED, HIGH and AUTO. The fan speed indicator light illuminates under different fan settings. When select AUTO fan speed, all the fan indicator lights turn dark. On

some models, when you select AUTO fan speed, all the fan indicator lights illuminate. NOTE: In cooling or Dry mode, press the button for 3 seconds to turn on or off the constant fan function. When the function is turned on, the constant fan light will illuminate, identifying the fan continuous run for cooling. When the function is turned off, the constant fan light will go out, identifying the fan cycle run with compressor stop.

Sleep(Eco) button

Used to initiate the SLEEP/ECO operation. Power button

Power switch on/off. LED display

Shows the set temperature in °C or °F("°F" no display for some models) and the Auto-timer settings. While on DRY and FAN modes, it shows the room temperature.

Shows Error codes and protection code: E1-Room temperature sensor error. E2-Evaporator temperature sensor error. E3-Condenser temperature sensor error (On some models).

E4-Display panel communication error. EC-Refrigerant leakage detection malfunction (On some models).

P1-Bottom tray is full--Connect the drain hose and drain the collected water away.If protection repeats,call for service.

Note: When one of the above malfunctions occurs, turn off the unit, and check for any obstructions. Restart the unit, if the malfunction is still present, turn off the unit and unplug the power cord. Contact the manufacturer or its service agents or a similar qualified person for service.

COOL operation

· Press the "MODE" button until the "COOL" indicator light comes on.

· Press the ADJUST buttons "+" or "-" to select your desired room temperature. The temperature can be set within a range of 62°F~86°F(or 88°F).

· Press the "FAN SPEED" button to choose the fan speed.

HEAT operation(cooling only models without)

· Press the "MODE" button until the "HEAT" indicator light comes on.

· Press the ADJUST buttons "+" or " - " to select your desired room temperature. The temperature can be set within a range of 62°F~86°F(or 88°F).

· Press the "FAN SPEED" button to choose the fan speed.

(20)

20

Page 20

Operating

Instructions

Other features

Note: For some models, the fan speed can not be adjusted under HEAT mode.

AUTO operation

· When you set the air conditioner in AUTO mode, it will automatically select cooling, heating(coolingonly models without), or fan only operationdepending on what temperature you have selectedand the room temperature.

· The air conditioner will control room temperature automatically around the temperature point set byyou. · Under AUTO mode, you can not select the fan speed. NOTE: Under AUTO mode, both the AUTO mode and the actual operation mode indicator lights illuminate for some models.

FAN operation

· Press the "MODE" button until the"FAN " indicator light comes on.

· Press the "FAN SPEED" button to choose the fan speed. The temperature can not be adjusted. · Do not put the duct to window.

DRY operation

· Press the "MODE" button until the "DRY" indicator light comes on.

· Under this mode, you cannot select a fan speed or adjust the temperature. The fan motor operates at LOW speed.

· Keep windows and doors closed for the best dehumidifying effect.

· Do not put the duct to window.

TIMER operation

· When the unit is on, pressing the Timer button will

initiate the Auto-off stop program, the TIMER OFF indicator light illuminates. Press the UP or DOWN button to select the desired time. Press the TIMER button again within 5 seconds, the Auto-on start program is initiated. And the TIMER ON indicator light illuminates. Press the up or down button to select the desired Auto-on start time.

· When the unit is off, press the Timer button to initiate the Auto-on start program, press it again within 5 seconds will initiate the Auto-off stop program. · Press or hold the UP or DOWN button to change the

Auto time by 0.5 hour increments, up to 10 hours, then at 1 hour increments up to 24 hours. The control will count down the time remaining until start.

· The system will automatically revert back to display the previous temperature setting if there is no operation in a 5 seconds period.

· Turning the unit ON or OFF at any time or adjusting the timer setting to 0.0 will cancel the Auto Start/ Stop timer program.

SLEEP(ECO) operation

· Press this button, the selected temperature will increase(cooling) or decrease(heating) by 2°F(or1°F) 30 minutes. The temperature will then increase (cooling) or decrease (heating) by another 2°F(or1°F) after an additional 30 minutes. This newtemperature will be maintained for 7 hours before itreturns to the originally selected temperature. Thisends the Sleep/ Eco mode and the unit will continueto operate as originally programmed.

NOTE: This feature is unavailabe under FAN or DRY mode.

FOLLOW ME/TEMP SENSING feature(On some models) NOTE:This feature can be activated from the remote control ONLY. The remote control serves as a remote thermostat allowing for the precise temperature control at its location.

To activate the Follow Me/Temp Sensing feature, point the remote control towards the unit and press the Follow Me/Temp Sensing button. The remote control will send this signal to the air conditioner until press the Follow Me/Temp Sensing button again. If the unit

does not receive the Follow Me/Temp Sensing signal during any 7 minutes interval, the unit will exit the Follow Me/Temp Sensing mode.

NOTE: This feature is unavailable under FAN or DRY mode.

AUTO-RESTART

If the unit breaks off unexpectedly due to the power

being cut, it will restart with the previous function setting automatically when the power resumes.

(21)

21

Page 21

Operating

Instructions

AIR FLOW DIRECTION ADJUSTMENT

The louver can be adjusted automatically. Adjust the air flow direction automatically:

· When the Power is ON, the louver opens fully. · Press the SWING button on the panel or remote

controller to initiate the Auto swing feature. The louver willl swing up and down automatically. · Please do not adjust the louver manually.

WAIT 3 MINUTES BEFORE RESUMING OPERATIONAfter the unit has stopped, it can not be restarted for operation in the first 3 minutes. This is to protect the unit. Operation will automatically start after 3 minutes. POWER MANAGEMENT feature(On some models) Under cooling operation, when the ambient

temperature is lower than the setting temperature for a period of time, the unit will automatically operate the power management feature. The compressor and fan motor stop. When the ambient temperature is higher than the setting temperature, the unit will automatically quit the power management feature. The compressor and (or) fan motor run.

Water drainage

· During dehumidifying modes, remove the upper drain plug from the back of the unit, install the drain connector(5/8" universal female mender) with 3/4" hose(locally purchased). For the models without drain connector, just attach the drain hose to the hole. Place the open end of the hose directly over the drain area in your basement floor.

MODEL A MODEL B Remove the

upper drain plug

√ Continuous drain hose

Remove the upper drain plug

√ Continuous drain hose

· During heating pump mode, remove the lower drain plug from the back of the unit, install the drain connector (5/8" universal female mender) with 3/4" hose(locally purchased). For the models without drain connector, just attach the drain hose to the hole. Place the open end of the Hose adaptor directly over the drain area in your basement floor.

that there are no kinks that will stop the water flowing. Place the end of the hose into the drain and make sure the end of the hose is down to let the water flow

smoothly.(See Figs with . Don't ever let it up.(See Figs with ). When the continuous drain hose is not used, ensure that the corresponding drain plug and knob are installed firmly to prevent leakage.

NOTE: Make sure the hose is secure so there are no leaks. Direct the hose toward the drain, making sure

√ X MODEL B √ drain hose adaptor Continuous drain hose Remove the lower drain plug

MODEL A √ drain hose adaptor Continuous drain hose Remove the lower drain plug

X drain hose adaptor

Press the power cord buckle into the rear cover. drain hose adaptor √ delivery lift <1.8m MODEL A1 Continuous drain hose Remove the lower drain plug

· (For model A1)During heating pump mode, remove the lower drain plug from the back of the unit, install the drain connector(5/8" universal female mender) with 3/4" hose(locally purchased). Carefully move the unit to a drain location, and let the water drain away. Note: Make sure the drain hose is lower than the bottom tray drain outlet.

· When the water level of the bottom tray reaches a predetermined level, the unit beeps 8 times, the digital display area shows "P1" . At this time the air conditioning/dehumidification process will immediately stop. However, the fan motor will continue to operate (this is normal). Carefully move the unit to a drain location, remove the bottom

drain plug and let the water drain away. Reinstall the bottom drain plug and restart the machine until the "P1" symbol disappears. If the error repeats, call for service. NOTE: Be sure to reinstall the bottom drain plug firmly to prevent leakage before using the unit.

(22)

22

Page 22

Maintenance lower filter A

Safety Precautions

Air Filter Cleaning

Unit Cleaning

Store the unit when not in use

Maintenance

· Always unplug the unit before cleaning or servicing.

· DO NOT use flammable liquids or chemicals to clean the unit.

· DO NOT wash the unit under running water. Doing so causes electrical danger.

· DO NOT operate the machine if the power supply was damaged during cleaning. A damaged power cord must be replaced with a new cord from the manufacturer.

CAUTION

DO NOT operate the unit without filter because dirt and lint will clog it and reduce performance.

Maintenance Tips

· Be sure to clean the air filter every 2 weeks for optimal performance.

· The water collection tray should be drained immediately after P1 error occurs, and before storage to prevent mold.

· In households with animals, you will have to

periodically wipe down the grill to prevent blocked airflow due to animal hair.

Clean the unit using a damp, lint-free cloth and mild detergent. Dry the unit with a dry, lint-free cloth.

· Drain the unit’s water collection tray according to the instructions in the following section. · Run the appliance on FAN mode for 12 hours in a warm room to dry it and prevent mold. · Turn off the appliance and unplug it.

· Clean the air filter according to the instructions in the previous section. Reinstall the clean, dry filter before storing.

· Remove the batteries from the remote control.

Note: Be sure to store the unit in a cool, dark place. Exposure to direct sunshine or extreme heat can shorten the lifespan of the unit.

Upper filter (take out)

MODEL A MODEL B MODEL C

Uper air filter (take out)

Lower air filter (take out)

Uper air filter (take out)

Note: The cabinet and front may be dusted with an oil-free cloth or washed with a cloth dampened in a solution of warm water and mildliquid dishwashing detergent. Rinse thoroughly and wipe dry. Never use harsh cleansers, wax or polish on the cabinet front. Be sure to wring excess water from the cloth before wiping around the controls. Excess water in or around the controls may cause damage to the unit.

lower filter B (take out)

(Press the grill down slightly and pull the lower filter A out at the same time)

(23)

23 Page 23

Troubleshooting

Tips

Troubleshooting Tips

Problem Possible Causes Solution

Unit does not turn on when pressing ON/OFF button

P1 Error Code

In COOL mode: room temperature is lower than the set temperature

Reset the temperature

The Water Collection Tray is full. Turn off the unit, drain the water from the Water Collection Tray and restart the unit.

The air filter is blocked with dust or animal hair

The unit is low on refrigerant

Temperature setting is too high

The windows and doors in the room are open

The room area is too large Unit does not cool

well

Exhaust hose is not connected or is blocked

There are heat sources inside the room

Turn off the unit and clean the filter according to instructions

Call a service technician to inspect the unit and top off refrigerant Decrease the set temperature

Make sure all windows and doors are closed Double-check the cooling area

Turn off the unit, disconnect the hose, check for blockage and reconnect the hose

Remove the heat sources if possible The unit is noisy

and vibrates too much

The unit makes a gurgling sound

The ground is not level Place the unit on a flat, level surface The air filter is blocked with

dust or animal hair Turn off the unit and clean the filter according to instructions This sound is caused by the

flow of refrigerant inside

the unit This is normal

Impedance Information

To be in compliance EN 61000-3-11, the product MPPD-14CRN1-QB6 shall be connected only to a supply of the system impedance: | Zsys|=0.346 ohms or less, the product MPPDB-12HRN1-QB6G1 shall be connected only to a supply of the system impedance: | Zsys|=0.337 ohms or less. Before connect the product to public power network, please consult your local power supply authority to ensure the power network meet above requirement.

(24)

Congratulations on purchasing your new HVAC equipment. It’s been designed for long life and reliable service, and is backed by one of the strongest warranties in the industry. Your unit automatically qualifies for the warranty coverage listed below, providing you keep your proof of purchase (receipt) for the equipment and meet the warranty conditions.

LIMITED ONE (1) YEAR EXPRESS WARRANTY

Comfort-Aire warrants this Room Air Conditioner to be free from defects in workmanship and materials for normal use and maintenance for one (1) year from the date of purchase by the original consumer. This Express Limited Warranty applies only when the Room Air Conditioner is installed and operated per Comfort-Aire installation and operating instructions for normal use.

EXCEPTIONS

The Limited Express Warranty does not cover normal maintenance Comfort-Aire recommends that regular inspection/maintenance be performed at least once a season. Additionally, labor charges diagnostic charges, transportation charges for replacement of

refrigerant or filters, and any other service calls/repairs are not covered by this Limited Warranty. It also does not cover any portion or component of the system that is not supplied by Comfort-Aire, regardless of the cause of failure of such portion or component. CONDITIONS FOR WARRANTY COVERAGE

Unit must be operated according to Comfort-Aire operating instructions included with the unit and cannot have been subjected to accident,alteration, improper repair, neglect or misuse, or an act of God(such as a flood)

• Serial numbers and/or rating plate have not been altered or removed

• •

Performance cannot be impaired by use of any product not authorized by Comfort-Aire, or by any adjustments oradaptations tocomponents

Damage has not been a result of inadequate wiring or voltage conditions, use during brown-out conditions, or circuit interruptions • Air flow around any section of the unit has not been restricted • Unit remains in the original installation

DURATION OF WARRANTY & REGISTRATION

The warranty begins on the date of purchase by the original consumer. The consumer must retain a receipted bill of sale as proof of warranty period. Without this proof, the express warranty begins on the date of shipment from the factory.

REMEDY PROVIDED BY THE LIMITED EXPRESS WARRANTY The sole remedy under the Limited Warranty is replacement of the defective unit. Labor to diagnose and replace the defective unit is not covered by this Limited Express Warranty. If for any reason the replacement product is no longer available during the warranty period, Comfort-Aire shall have the right to allow a credit in the amount of the current suggested retail price of the product instead of providing replacement.

LIMITATION OF LIABILITY

1. There are no other express or implied warranties. Comfort-Aire makes no warranty of merchantability. We do not warrantthat the unit is suitable for any particular purpose or can be

used in buildings or rooms of any particular size or condition except as specifically provided in this document. There are no other warranties, express or implied, which extend beyond the description in this document.

2. All warranties implied by law are limited in duration to the one-term of the warranty. We will not be liable for any consequential or incidental damages caused by any defect in this unit.

3. This warranty gives you specific legal rights and you may also have other rights which vary from state to state. Some states do not allow limitation on how long an implied warranty lasts or do not allow the exclusion or limitation of incidental or consequential damages, so the above limitations or exclusions may not apply to you. 4. No warranties are made for units sold outside the continental

United States and Canada. Your distributor or final seller may provide a warranty on units sold outside these areas. 5. Comfort-Aire will not be liable for damages if ourperformance

regarding warranty resolution is delayed by eventsbeyond our control including accident, alteration, abuse, war, government restrictions, strikes, fire, flood, or other acts of God.

HOW TO SUBMIT A WARRANTY CLAIM

If you have a warranty claim, notify you installer or dealer promptly.

KEEP THIS INFORMATION AS A RECORD OF YOUR PURCHASE PRODUCT IDENTIFICATION INSTALLATION

Model Number Installer Name (if used)

Serial Number Phone Number/Contact Information Date of Purchase Date Installation Completed

Remember to retain your bill of sale as proof of warranty period.

LIMITED EXPRESS WARRANTY

Comfort-Aire_9-2018

Please visit

www.marsdelivers.com

(25)

:HOOZRUWK$YH-DFNVRQ0,‡3K‡ZZZKHDWFRQWUROOHUFRP 'XHWRRQJRLQJSURGXFWLPSURYHPHQWVVSHFLILFDWLRQVDQGGLPHQVLRQVDUH VXEMHFWWRFKDQJHDQGFRUUHFWLRQZLWKRXWQRWLFHRULQFXUULQJREOLJDWLRQV'HWHUPLQLQJWKH DSSOLFDWLRQDQGVXLWDELOLW\IRUXVHRIDQ\SURGXFWLVWKHUHVSRQVLELOLW\RIWKHLQVWDOOHU $GGLWLRQDOO\WKHLQVWDOOHULVUHVSRQVLEOHIRUYHULI\LQJGLPHQVLRQDOGDWDRQWKHDFWXDOSURGXFW SULRUWREHJLQQLQJDQ\LQVWDOODWLRQSUHSDUDWLRQV ,QFHQWLYHDQGUHEDWHSURJUDPVKDYHSUHFLVHUHTXLUHPHQWVDVWRSURGXFWSHUIRUPDQFH DQGFHUWLILFDWLRQ$OOSURGXFWVPHHWDSSOLFDEOHUHJXODWLRQVLQHIIHFWRQGDWHRIPDQXIDFWXUH KRZHYHUFHUWLILFDWLRQVDUHQRWQHFHVVDULO\JUDQWHGIRUWKHOLIHRIDSURGXFW 7KHUHIRUHLWLVWKHUHVSRQVLELOLW\RIWKHDSSOLFDQWWRGHWHUPLQHZKHWKHUDVSHFLILF PRGHOTXDOLILHVIRUWKHVHLQFHQWLYHUHEDWHSURJUDPV 5/2020 ZZZPDUVGHOLYHUVFRP 1900 Wellworth Ave., Jackson, MI 49203 • Ph. 517-787-2100 • www.marsdelivers.com

References

Related documents

The completion of the Ph.D.’s Ten Years Later study, a national study of the career paths of doctoral degree recipients, has allowed us to provide detailed information about the

An analysis of the economic contribution of the software industry examined the effect of software activity on the Lebanese economy by measuring it in terms of output and value

In addition, if I marked &#34;Yes&#34; to any of the above questions, I hereby authorize release of information from my Department of Transportation regulated drug and alcohol

Remote sites without an ISDN line would require a bridge to connect their IP line to the Senate/HoC committee room’s ISDN line.. Date October 20, 2015 Date October

Petitioner may reserve a maximum of five (5) minutes for rebuttal by notifying the bailiff before the judges enter the courtroom. Petitioner must still formally

The effort to open up markets for international trade in services results in the necessity of subordinating short- term national interests to a certain extent to long-term

The consultation ‘agenda’ document cited household income, consumption expenditure, material deprivation indicators and subjective satisfaction measures as four of the main

Prof Shunji Matsuoka, a professor at Waseda University and also the general manager of the Campus Asia-EAUI programme, said: “We found that having a regional wide graduate