• No results found

A Hybrid Lagrangian Search Ant Colony Optimization Algorithm for the Multidimensional Knapsack Problem

N/A
N/A
Protected

Academic year: 2021

Share "A Hybrid Lagrangian Search Ant Colony Optimization Algorithm for the Multidimensional Knapsack Problem"

Copied!
11
0
0

Loading.... (view fulltext now)

Full text

(1)

Procedia Computer Science 60 ( 2015 ) 1109 – 1119

1877-0509 © 2015 The Authors. Published by Elsevier B.V. This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/).

Peer-review under responsibility of KES International doi: 10.1016/j.procs.2015.08.158

ScienceDirect

19th International Conference on Knowledge Based and Intelligent Information and Engineering

Systems

A Hybrid Lagrangian Search Ant Colony Optimization algorithm

for the Multidimensional Knapsack Problem

Wafa Nakbi

a

, Ines Alaya

a

*, Wiem Zouari

a a COSMOS-ENSI, University of Manouba, Manouba 2010

Abstract

Multidimensional knapsack problem (MKP) is an NP-hard problem, the goal of which is to find a subset of objects that maximizes a given objective function while satisfying some resource constraints. To be solved in a relatively short time an approximate method that returns near-optimal solutions can or, often, should be used, especially for large and hard instances. In this paper, an approximate method combining Ant Colony Optimization (ACO) metaheuristic and Lagrangian heuristic is proposed to solve MKP. The idea is to use the solutions obtained by the Lagrangian heuristic to guide ants in their search of good paths by laying pheromone trails. Experiments on large benchmark instances on MKP show that the hybrid algorithm performs better than the ACO algorithm and the Lagrangian heuristic when tested separately.

© 2015 The Authors. Published by Elsevier B.V. Peer-review under responsibility of KES International.

Keywords: Multidimentional Knapsack Problem; Lagrangian Heuristic; Ant Colony Optimization; Hybrid Metaheuristics

1. Introduction

The multidimensional knapsack problem (MKP) is a generalization of the classical knapsack problem (KP). It aims at finding a subset of objects that maximizes the total profit while satisfying some resource constraints. Formally, the MKP can be stated as follows:

* Corresponding author

E-mail address: [email protected]

© 2015 The Authors. Published by Elsevier B.V. This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/).

(2)

x

p

j n j j

¦

=1

max

(1) Subject to

m

i

b

x

a

n j i j ij

,

1

,...,

1

=

¦

= (2)

}

{

j

n

x

j

0

,

1

,

1

,...,

(3)

where ݔ௝is a decision variable associated with object j, which has value 1 if the object j is added to the knapsack and

0 otherwise, n is the number of objects, ݌௝ is the profit associated with the object j, ܽ௜௝ is the resource requirement of

the object j with respect to resource constraint i, ܾis the capacity of the resource i, and m is the number of resource constraints.

In this paper, we propose a hybrid approach, to solve this problem, combining ACO with a state-of-the-art Lagrangian heuristic: Lagrangian Search Ant Colony Optimization (LSACO). The lagrangian heuristic used in the combination is the algorithm “Feasibility-pursuing Lagrangian search” (FPLS)17. The idea of LSACO is to use

artificial ants to find good solutions that will be rewarded by pheromone trails, and to use additional pheromone reward for solutions obtained by the Lagrangian heuristic. In the next section, we present the basic idea of Ant Colony Optimization (ACO) and some related works for solving MKP. Then, section 3 introduces the Lagrangian heuristic and defines the FPLS algorithm. In section 4, the new hybrid algorithm LSACO is proposed, and finally experimentations and results of this algorithm on the MKP problem are given in section 5.

2. Ant Colony Optimization

The ACO is a metaheuristic inspired from the real ants’ behavior seeking a path between their colony and the food source. It is based on the indirect communication between ants mediated by trails of a chemical substance called ‘pheromone’. This metaheuristic could be applied to solve a large class of problems. For the MKP, several ACO algorithms were proposed in the literature.

To solve MKPs with ACO, the key point is to decide which components of the constructed solutions should be rewarded, and how to exploit these rewards when constructing new solutions. Another important point is the definition of the heuristic information used in the probability transition.

The first ACO algorithm applied to the MKP was proposed by Leguizamon and Michalewizc9. In this algorithm,

pheromone trails are associated with objects. The heuristic information is calculated each time the ant adds an object to the solution, so it is considered dynamic.

Another application of ACO to MKP was introduced by Fidanova4 in which pheromone trails are laid on the path

constructed by selected objects. Additional pheromone trails are deposited on path formed by the best ant. In this application, the heuristic information is statically calculated.

Alaya et al2 proposed a generic ACO algorithm for the MKP, Ant-Knapsack. This algorithm is generic in the

sense where it is parameterized by the components on which the pheromone trails are laid. Three instantiations of this algorithm were proposed: Vertex-AK where the pheromone is laid on each object selected in the solution, Path-AK where the pheromone is deposited on each pair of successively selected objects and Edge-AK where the pheromone is laid on all pairs of diơerent selected objects. The latter instantiation takes up the algorithm proposed in 1. By

comparing these three instantiations, they found that Vertex-AK and Edge-AK gives results better than those given by Path-AK. They found also that Edge-AK performs better than Vertex-AK over most of the considered instances.

One more application of ACO to MKP called “Binary Ant System (BAS)” was proposed by Min et al.11. This

application is different from the applications we mentioned earlier. In fact, the deposit of pheromone is specific in the structures of binary solutions. Furthermore, this algorithm authorizes the generation of non-feasible solutions in the

(3)

construction procedure, which will be then rectified, at each iteration, through a repair operator.

More recently, Lee and Bau8 proposed an ACO algorithm for MKP, called ‘preference-list ACO algorithm with

mutation’ (PACOM). In this algorithm a preference list is introduced to determine the number of objects to be considered. Non-feasible solutions are also considered in the construction phase to decrease the execution time. They are then rectified through a repair operator and, once a solution is built, a mutation operator is performed to increase the probability of finding an optimal solution.

3. Lagrangian Search

Lagrangian heuristic5 has been extensively used to find an upper bound for maximization problems. This bound is

used in some algorithms in order to find better solutions. However, researches that focus on obtaining a lower bound and therefore a feasible solution to a maximization problem are far fewer.

For the MKP, Magazine and Ogus10 were the first to propose a Lagrangian method MO-CONS to obtain a lower

bound. MO-CONS is a heuristic method that uses relaxation. The relaxation of the problem is performed initially by setting all variables to 1, thus the vector of Lagrange multiplier is initially null.

Later, Raidl 13 has improved the algorithm MO-CONS by combining this algorithm with genetic algorithm. More

recently, Yoon et al.17 have proposed FPLS, a variant of MO-CONS. In this heuristic, they reintroduce Lagrangian

capacity suitable for MKP, since they observed that the hardness of Lagrangian search is closely related to the capacity value of the given problem instance. We define in the following the FPLS heuristic17 that we propose to use in the

proposed hybrid algorithm, that will be defined later. 3.1. Lagrangian Capacity

The FPLS heuristic is based on the principle of Lagrangian capacity reintroduced in17 for the MKP. We define in

this section, briefly, this Lagrangian capacity as proposed in 17.

The MKP (1) can be reformulated as

x

p

T

max

(4)

b

Ax

(5)

}

{

n

x

0

,

1

(6)

with ݌ ൌ ሺ݌ଵǡ Ǥ Ǥ ǡ ݌௡ሻ் and ݔ ൌ ሺݔଵǡ Ǥ Ǥ ǡ ݔ௡ሻ் are two vectors of dimension n, ܣ ൌ ሺܽ௜௝ሻ௜ୀଵǤǤ௠ǡ௝ୀଵǤǤ௡ is a matrix of

dimension ݊ ൈ , and ܾ ൌ ሺܾଵǡ Ǥ Ǥ ǡ ܾ௠ሻ் is an m-dimensional vector called capacity, and T means the transpose of a

matrix or a column vector.

To define the Lagrangian capacity, we will use the following notations: ݑ א Թ௠

ȳ ൌ ሼͲǡ ͳሽ୬

߱ሺܾሻ ൌ ƒšሼ ݌்ݔǣ ݔ א ȳǡ ܣݔ ൑ ܾሽǡ where b is the capacity vector

ܺሺݑሻ ൌ ሼݔ א ȳǣ݌்ݔ െ ݑܣݔ ൒ ݌ݕ െ ݑܣݕǡ ׊ݕ א ȳ} such that ܺሺݑሻ is the set-valued function which maps

a vector ݑ in the maximizers of ݌்ݔ െ ݑ்ܣݔ

߱ሺܾሻis the maximum of the objective function when the capacity is ܾ and ܺሺݑሻis the set-valued function which maps a given real vector ݑ into the maximizers of ݌்ݔ െ ݑ்ܣݔ.

If the domain is convex and the problem satisfies several necessary conditions, there always exists a real vector ݑ ൒ Ͳ such that ߱ሺܾሻ ൌ ݌்ݔ െ ݑ்ሺܣݔ െ ܾሻ. The unconstrained problem of maximizing ݌்ݔ െ ݑ்ሺܣݔ െ ܾሻ can be solved instead of the given constrained problem and such ݑ can be found. This method is called Lagrangian method and the real vector ݑ used in this method is called Lagrange multiplier. However, for problems with discrete domain there are several conditions to be satisfied when using Lagrangian method. We state in the following the capacity condition,

(4)

further details can be found in 17.

The value of the capacity which lets the equality ߱ሺܾሻ ൌ ݌்ݔ െ ݑ்ሺܣݔ െ ܾሻ hold for some ݑ is called Lagrangian capacity. A capacity ܾഥis called Lagrangian capacity if there isݑത ൒ Ͳ such that

0

)

(

A

x

b

=

u

T (7)

b

x

A

(8)

where ݑത is the vector of Lagrangian multipliers associated with ܾതand ݔҧis called the vector solution associated with

ܾത.

3.2. Lagrangian method for MKP (LMMKP)

The algorithm Lagrangian method for the MKP (LMMKP) generates the Lagrangian capacity that will be used in the FPLS algorithm. This algorithm, as described in 17, can be applied to various values of ݑ ൒ Ͳ. Thus, when applying

several times LMMKP, a set of Lagrangian capacities associated with multipliers and the corresponding optimal solutions are obtained. Among them, the nearest one to b, the capacity of the given problem, is chosen. The selected capacity ܾכሺൌ ܣݔכሻ has to be less than or equal to b since the solution ݔכ must satisfy the constraint of the given problem instance, i.e., ܣݔכ ൑ ܾ.

The pseudo-code of LMMKP algorithm is outlined in Fig.1. LMMKP has as input a multipliers’ vector ݑǡ the profit vector p and the weight matrix A. It returns a vector ܾכ of lagrangian capacities, the optimal solution ݔכ associated to ܾכ and ߤכ a multipliers’ vector of the optimal solution associated to ܾכ.

LMMKP algorithm LMMKP (ݑ, p, A) For j=1 to n do If݌൐ σ௠௜ୀଵݑܽ௜௝ Thenݔ௝כ՚ ͳ Otherwiseݔכ՚ Ͳ End if ܾכ՚ ܣݔכ ߤכ՚ ݌ݔכ End for Returnߤכǡ ܾכǡ ݔכ

Fig. 1. The LMMKP pseudo-code.

3.3. Feasibility-Pursing Lagrangian Search (FPLS)

The FPLS is a Lagrangian heuristic proposed in 17. The goal of FPLS is to find a vector

u

, such that the

corresponding Lagrangian capacity value is as close as possible to the capacity of the original problem. To achieve this, the method LMMKP is used for a fixed number of iterations N.

FPLS is based on the generation of Lagrangian capacities and the improvement of the solution by modifying the Lagrange multipliers. The method chooses a random number ݇ሺ൑ ݉ሻ and increases or decreases the value of ݑ௞. At each iteration, a Lagrangian capacity ܾכ is obtained by applying LMMKP with ݑ. If ܾכ൑ ܾ then all constraints are satisfied and hence the best solution is updated. Since it is possible to find better Lagrangian capacity, the algorithm continues iterating. Instead, it chooses a random number k and decreases the value of ݑ௞Ǥ Otherwise, ܾכ൐ ܾ , the algorithm focuses on satisfying the constraints. Therefore, a number k is chosen randomly among the unsatisfied constraints and the multiplierݑ௞ increases hoping that the kth value of the Lagrangian capacity decreases and thus the

(5)

kth constraint is satisfied.

In general, Lagrangian heuristics for discrete problems have focused on obtaining good upper bounds, but this algorithm primarily pursues finding feasible solutions. Thus, it is called Feasibility-Pursuing Lagrangian Search (FPLS). The FPLS pseudo-code is described in Fig.2. It has as input, the weight matrix A, the capacity vector b and the profit vector p. The number of iterations, ܰ, and ߛ are parameters to be fixed.

FPLS algorithm FPLS (A, b, p) ݑ ՚ Ͳ Forݐ ൌ ͳto ܰdo ߜ ՚ ଵ ௧ାఊିଵ ሺߤכǡ ܾכǡ ݔכሻ ՚ ࡸࡹࡹࡷࡼሺݑǡ ݌ǡ ܣሻ ܫ ՚ ሼ݅ȁܾ௜כ൑ ܾ௜ሽand ܬ ՚ ሼ݅ȁܾ௜כ൐ ܾ௜ሽ

Ifܫ ൌ ሼͳǡ Ǥ Ǥ ǡ ݉ሽ (all constraints are satisfied) then Update the best solution

Choose randomly an element݇ א ܫ ݑ՚ ݑെ ߜ

Else

Choose randomly an element ݇ א ܬ ݑ௞՚ ݑ௞൅ ߜ

End if End for

Return the best solution

Fig. 2. The FPLS pseudo-code.

4. The LSACO Algorithm

We propose in this section a hybrid algorithm, Lagrangian Search Ant Colony Optimization (LSACO), which combines ACO and the Lagrangian heuristic FPLS. Basically, LSACO follows the 0$;−0,1 Ant System scheme15. To prevent premature convergence, pheromone trails are bounded within lower and upper bounds IJ

min and

IJmax (with 0 < IJmin < IJmax ), and set to IJmax at the beginning of the search.

At each cycle of this algorithm, every ant constructs a solution. Once the ants construction phase is achieved, the FPLS heuristic is called, and pheromone trails are laid on the best ant’s solution and also on the FPLS solution. The algorithm is outlined in Fig.3.

4.1. Solution construction

In order to construct its solution, at each construction step each ant chooses an item oj to add to the solution Sk

among the set of candidate items Candidates with the probability

p

Sk

(

o

j

)

defined in equation (9). Then, Candidates is updated by removing the items that violate constraints. The solution construction algorithm is described in Fig 4.

The probability

p

Sk

(

o

j

)

is given as follows :

[

] [

]

[

] [

]

¦

=

Candidates o S j S j j S j S j S j k k k k k

o

o

o

o

o

p

α β β α

η

τ

η

τ

)

(

)

(

)

(

)

(

)

(

(9) where S

(

o

j

)

k

τ

is the pheromone factor of ݋, S

(

o

j

)

k

η

is the heuristic factor, and Į and ȕ are two parameters that determine the relative importance of these two factors.
(6)

The pheromone factor depends on the quantity of pheromone laid on edges connecting the objects that already are in the partial solution Sk and the candidate node oj:

¦

=

k i k k S o i j S j S

(

o

)

τ

(

o

,

o

)

τ

(10) Algorithm. LSACO

Initialize pheromone trails to ߬௠௔௫ Repeat

For each ant k in 1..nbAnts do Construct a solution ܵ௞ Update ܵ௕௘௦௧

End for FPLS (A, b, p)

Update pheromone trails on the best ant cycle solution ܵ௞ Update pheromone trails on the FPLS solution

If some trail is lower than IJmin then set it to IJmin

If some trail is greater than IJmax then set it to IJmax

Until a maximum number of cycles is reached

Fig. 3. LSACO pseudo-code.

Algorithm. Construct a solution

Select randomly a first object ݋ଵא ͳǤ Ǥ ݊ ܵ௞՚ ሼ݋ଵሽ

ܥܽ݊݀݅݀ܽݐ݁ݏ ՚ ሼ݋௝ǡ ݆ א ͳǤ Ǥ ݊ȁ݋௝ ݏ݈݁݁ܿݐ݁݀ݓ݅ݐ݄݋ݑݐݒ݅݋݈ܽݐ݅݊݃ݎ݁ݏ݋ݑݎܿ݁ݏ ܿ݋݊ݏݐݎܽ݅݊ݐݏሽ

Whileܥܽ݊݀݅݀ܽݐ݁ݏ ് ׎do

Choose an object ݋௝ א ܥܽ݊݀݅݀ܽݐ݁ݏwith probability

݌ௌೖ൫݋௝൯

ܵ௞՚ ܵ௞׫ ሼ݋௝ሽ

Remove from ܥܽ݊݀݅݀ܽݐ݁ݏ each object that violates resource constraints End While

Fig.4. The construction procedure

4.2. Heuristic information The heuristic factor S

(

o

j

)

k

η

used in the transition probability is a problem specific heuristic. It should reflect the utility of adding the candidate object

o

j to the solution under construction. We propose to use and compare two heuristic information.

4.2.1. Lagrange multipliers based heuristic (H1)

We propose, first, to use a heuristic information used in classical greedy algorithms and that was applied for tabu search by Hanafi and Freville 6, defined as follows:

j

uA

)

(

j j S

p

o

k

=

η

(11)
(7)

4.2.2. Pseudo-utility ratio heuristic (H2)

As a second heuristic information, we use the one proposed in 1 which is defined as follows:

)

(

)

(

j S j j S

o

h

p

o

k k

=

η

(12) where

h

S

(

o

j

)

k measures the tightness of the object

o

j on the constraints i relatively to the constructed solution

ܵ௞. Thus, the lower this ratio is, the more the object is profitable. It is calculated as follows:

¦

=

=

m i S ij j S

i

d

a

o

h

k k 1

(

)

)

(

(13)

and ݀ௌೖሺ݅ሻ ൌ ܾ௜െ σ௚אௌೖܽ௜௚ is the remaining capacity of resource i when an ant k built the solutionܵ௞.

4.3. Pheromone update

As discussed earlier, we choose to deposit pheromone on each pair of selected objects in the solution since it gives generally the best results when compared to the other strategies on the MKP in 2.

Once all ants finish the construction of their solutions, the pheromone trails are updated. First, the pheromone trails are decreased, in order to simulate evaporation, by multiplying each component by a pheromone persistence ratioሺͳ െ

ߩሻ, such thatͲ ൑ ߩ ൑ ͳ. Then an amount of pheromone is laid for the best solution found by ants in the current cycle and also on the solution returned by FPLS. The amount of trail is laid on each pair of different selected items in the solution and calculated as follows:

)

(

)

(

1

1

k best

profit

S

S

profit

+

(14)

where ܵ௕௘௦௧ is the best solution built since the beginning and ܵ is the best solution of the cycle built by ants or the FPLS solution.

5. Experimentations and Results

We present in this section the results of the experiments realized on multidimensional knapsack problem (MKP). The benchmark instances and the best results used in the comparison are from OR-Library and available at http://www.cs.nott.ac.uk/~jqd/mkp/.

We compare the results of the hybrid algorithm LSACO, with the two heuristic information H1 and H2, with Ant-knapsack1 and FPLS17. All these algorithms were implemented in C++ and tested in the same experimental conditions.

For each compared algorithm, and for each instance, we performed 10 runs and we present the average gap of the obtained results indicating the distance to the optimum or the best known result in the literature. This average is defined byͳͲͲ ൈ஻௘௦௧ିோ௘௦௨௟௧

஻௘௦௧ , where ܤ݁ݏݐ is the optimum or the best known result in the literature for the instance.

In the following, we discuss about the parameters setting and benchmark sets before detailing results. 5.1. Parameters setting

We have done experimentations on some MKP instances to choose the parameters values. For the parameters of LSACO and Ant-knapsack algorithms, we set the bounds values ߬௠௜௡to 0.01, ߬௠௔௫to 6, the evaporation ratio ȡ to

0.01, the number of cycles to 500, Į, the weight of pheromone factor, to 1, and ȕ, the weight of heuristic factor, to 5. We set the number of ants to 10 for LSACO, while for Ant-Knapsack algorithm we set it to 20. For FPLS algorithm,

(8)

experiments have led us to set the value of ߛ to 30 and the number of iterations to 250. 5.2. Test data

We have tested all the algorithms on the small and large instances of OR-Library. The small benchmarks are the instances of Petersen12, Weingartner and Ness 16, Senyu and Toyoda 14. We present in the following the results on the

largest instances of Chu and Beasley3 benchmarks. There are 9 instances sets of 30 problems with sizes 5, 10 and 30

constraints × 100, 250 and 500 items. For these instances, optimal solutions of problems are not all known due to their large sizes.

These instances have different tightness ratiosߙ, which are the values such that „ൌ Ƚ σ୬୨ୀଵƒ୧୨ for each‹ א

ሼͳǡ ǥ ǡ ሽ. Based on this definition, we could conclude that more the ratio is high more the problem is hard. Each set of 30 instances is divided into 3 sets according to a hardness ratio equal to 0.25; 0.5 and 0.75.

5.3. Results

5.3.1. Small instances

We have tested LSACO algorithm on instances of Petersen12, Weingartner and Ness 16, Senyu and Toyoda 14. The

results found, that we don’t present in details due to space limitations, show that the algorithm returns almost always the optimal solution. In fact, for most of the instances the optimal solution was found 10 times /10.

5.3.2. Chu and Beasley instances

We present in this section the results for instances with m = 30 constraints since they are the most difficult instances for these benchmark sets and for which the optimal solution is not always known.

The table 1 compares results found by LSACO with both of heuristics H1 and H2 with those of Ant-knapsack and FPLS. This table present the average gap of the obtained results indicating the distance to the optimum or the best-known result in the literature.

First, when comparing LSACO with the first and second heuristic information, it is clear that H2 using the pseudo-utility factor finds results widely better than the heuristic H1 using the Lagrangian multipliers on all the tested instances. This latter finds also less better results than Ant-knapsack and FPLS when tested separately. It is clear that this heuristic didn’t guide correctly ants in their search to find good solutions.

When comparing LSACO-H2 with Ant-knapsack and FPLS, we remark that LSACO-H2 find the best results on all the tested instances.

For the first benchmark set, with 100 items, the LSACO-H2 algorithm gives the best results compared to the Ant-Knapsack algorithm as well as to FPLS algorithm. One can also remark that more problems are hard more the solutions found by the LSACO algorithm are close to the optimum: the gap is 0.41 for the hardest instances with tightness ratio

ߙ ൌ ͲǤ͹ͷ. Moreover, although for some instances (as the instance ͵Ͳ ൈ ͳͲͲ െ ͲǤʹͷ̴͹) results obtained by both of compared algorithms are relatively far from the optimum (for the instance ͵Ͳ ൈ ͳͲͲ െ ͲǤʹͷ̴͹ Ant-Knapsack obtains

ͷǤ͵ͷΨ and FPLS ͶǤ͵ͷΨ), LSACO succeeded to find solutions close to the optimum (ͳǤͷʹΨ). We note that for some instances, as the instance͵Ͳ ൈ ͳͲͲ െ ͲǤ͹ͷ̴ͳ, the proposed algorithm has found almost always (9 times out of 10) the optimal solution.

The same for the two other benchmark sets with 250 and 500 items, LSACO-H2 algorithm returns largely the best results. And also for these two sets with 250 and 500 items, the algorithm succeeded to find solutions very close to the optimum for the hardest instances (ߙ ൌ ͲǤ͹ͷ) since the average gaps are respectively ͲǤ͸ͻΨ and ͲǤ͸͵Ψ. To summarize, the hybrid algorithm LSACO (with H2) outperforms the ACO algorithm and the Lagrangian heuristic when tested separately. Thus, the additional pheromone reward by solutions found by the Lagrangian heuristic seems to guide the ants in a better way. One can also remark the importance of heuristic information, since the performance of LSACO clearly decreases when using a different heuristic (H1).

(9)

Table 1. Average gap results of LSACO-H1/H2, Ant-knapsack and FPLS on large Chu and Beasley instances (m=30 and n =100, 250 and 500). The instances are grouped by the tightness ratio, thus each line shows the average results of the 10 instances of the corresponding ratio tested each one for 10 runs.

Instance LSACO Ant-Knapsack FPLS

H1 H2 30x100-0.25 9.4 1.85 2.83 5.52 30x100-0.50 7.9 1.02 1.74 2.87 30x100-0.75 4.3 0.41 0.91 1.38 Average 7.2 1.09 1.82 3.25 30x250-0.25 14.4 2.03 4.14 4.27 30x250-0.50 10.6 1.24 2.16 2.66 30x250-0.75 6.15 0.69 1.37 1.28 Average 10.38 1.32 2.55 3.73 30x500-0.25 16.76 3.24 4.42 3.82 30x500-0.50 13.05 1.19 1.94 2.66 30x500-0.75 6.12 0.63 2.2 1.28 Average 11.9 1.68 2.85 2.58 6. Conclusion

The multidimensional knapsack problem has been extensively studied because of its theoretical and practical importance. We have proposed in this paper a hybrid Lagrangian search ACO algorithm, LSACO, to solve it. This algorithm consists in integrating the Lagrangian heuristic in the ACO algorithm by laying pheromone trails on the solution returned by the Lagrangian heuristic.

To evaluate the proposed algorithm, we have tested LSACO on different instances of literature and compared it to the ACO algorithm and to the Lagrangian heuristic algorithm that were combined. The results show that LSACO find almost always the optimal solution for small instances in the literature. For large instances, the results found by LSACO are clearly better than those of ACO and Lagrangian heuristic. Thus, we can conclude the importance of the additional pheromone reward by solutions found by the Lagrangian heuristic. However, the LSACO version using a Lagrangian multipliers based heuristic information doesn’t find good results, which shows the importance of heuristic information in ants search. Therefore, the effectiveness of ACO depends on the definition of the two key points: pheromone trails and heuristic information. We have combined in this paper ACO with Lagrangian heuristic, it would be interesting to test combination with other relaxation based heuristics, and propose new heuristics that guide ants in their search in a better way.

References

1. Alaya I, Solnon C, Ghedira K. Ant algorithm for the multi-dimensional knapsack problem. Proceedings of International Conference on Bioinspired Optimization Methods and their Applications (BIOMA 2004); 2004. p. 63–72.

2. Alaya I, Solnon C, Ghédira K. Ant Colony Optimization for Multi-objective Optimization Problems. 19th

IEEE International Conference on Tools with Artificial Intelligence (ICTAI'07); 2007. p. 450-457.

3. Chu P. C, Beasley J. E. A genetic algorithm for the multidimensional knapsack problem. Journal of heuristics 1998. 4(1): 63-86. 4. Fidanova S. Evolutionary Algorithm for Multidimensional Knapsack Problem. PPSNVII- Workshop; 2002.

5. Fisher M. L. The Lagrangian relaxation method for solving integer programming problems, Management Science 2004. 50(125): 1861– 1871.

6. Hanafi S, Fréville A. An Efficient Tabu Search Approach for the 0-1 Multidimensional Knapsack Problem. European Journal of Operational Research 1998.

7. Kong M, Tian P, Kao Y. A new ant colony optimization algorithm for the multidimensional Knapsack problem. Computers & Operations Research 2008. 35(8): 2672-2683.

(10)

8. Lee S. Y, Bau Y. T. An ant colony optimization approach for solving the Multidimensional Knapsack Problem. In Computer & Information Science (ICCIS), 2012. p. 441-446.

9. Leguizamon G, Michalewicz Z. A new version of ant system for subset problems. In Proceedings of the 1999 Congress on Evolutionary Computation Piscataway, New Jersey, USA;1999. p. 1458-1464.

10. Magazine M. J, Oguz O. A heuristic algorithm for the multidimensional zero-one knapsack problem. European Journal of Operational Research 1984, 16(3): 319-326.

11. Min K, Peng T, Yucheng K. A new ant colony optimization algorithm for the multidimensional Knapsack problem. Comput. Oper. Res. 2008. 35(8): 2672-2683.

12. Petersen C. Computational experience with variants of the Balas algorithm applied to the selection of R&D projects. Management Science 1967,13(9): 736-750.

13. Raidl G. R. An improved genetic algorithm for the multiconstrained 0-1 knapsack problem. In Evolutionary Computation Proceedings, 1998. IEEE World Congress on Computational Intelligence;1998. p. 207-211.

14. Senyu S, Toyoda Y. An approach to linear programming with 0-1 variables. Management Science 1968 , p196-207. 15. Stützle T, Hoos H. MAX −MIN Ant System, Journal of Future Generation Computer Systems 2000; (16): 889- 914.

16. Weingartner H. M, Ness D. N. Methods for the solution of the multidimensional 0/1 knapsack problem. Operations Research 1967. 15(1): 83-103.

17. Yoon Y, Kim Y. H, Moon B. R. A theoretical and empirical investigation on the lagrangian capacities of the 0-1 multidimensional knapsack problem. European Journal of Operational Research 2012, (218): 366–376.

(11)

Changes made to the revised paper :

In the following the requirements of the reviewers (in blue) and the changes made to satisfy these requirements (in black)

Reviewer 1

,QWURGXFWLRQWKHDXWKRUVIRUJRWWRGHILQHQWKHQXPEHURIREMHFWV) definition added

1H[WSDUDJUDSK

HWDOPXVWEHLQLWDOLFdone

7KHUHIHUHQFH7SHQJ.<XFKHQ'2(6127(;,67DQGUHIHUHQFHLVKDQDILDQGIUHYLOOH

Reference 11 is added for Min K, Peng T, Yucheng K (sorry for this big mistake: we have submitted the wrong version with references not updated)

WKURXJKDUHSDLURSHUDWRU\RXPHDQWKDWPLQLPLVHWKHQRIHDVDELOLW\IDFWRU yes

/HHHWDOLVWKHUHIHUHQFHQXPEHU127Done with the new reference number

/DJUDQJLDQVHDUFK

3OHDVHDGGDUHIHUHQFHVRIWKHRULJLQRIWKH/DJUDQJLDQVHDUFK Reference 5( Fisher M. L ) is added

)3/6"""""" is defined in the introduction:” Feasibility-pursuing Lagrangian search (FPLS)” (we have modified the introduction of the proposed algorithm LSACO if it seems posing ambiguity)

3OHDVHDGGWKHLQWHUSUHWDWLRQRIHTXDWLRQ section 3.1 is modified to explain equation 7 and the Lagrangian capacity

3OHDVHDGGWKHLQSXWVDQGRXWSXWVRI\RXUDOJRULWKPV Done in algorithm description

3DUDJUDSKEHIRUHDGG36.RMLVJLYHQDVIROORZ Done 3DUDJUDSK\RXUUHIHUHQFHLV+DQDILDQGIUHYLOOH127IUHYLOOH Done 3DUDJUDSKUHVXOW"VPDOOLQVWDQFHV\RXUUHIHUQFHZHLQJDUWQHUDQGQHVVLVLQQRW Done &DQ\RXFRPSDUHWKHSHUIRUPDQFHVRI\RXUDSSURDFKZLWKWKHEHVWUHVXOWVSXEOLVKHGIRUWKHPXOWXLSOH NQDSVDFNSUREOHP""3OHDVHUHIHUWRKWWSZZZFVQRWWDFXNaMTGPNSEHVWUHVXOWVKWPO

We compare in the article the gap between the results found and the optimum or the best known result in the literature (from this link). As described in section 5.

We add more description in the table 1 title. Reviewer 2

/DJUDQJLDQKHXULVWLFLVXVXDOO\XVHGWRILQGXSSHUERXQGVIRUPD[LPL]DWLRQSUREOHPVEXWDQXSSHU ERXQGGRHVQWDOZD\VUHSUHVHQWDIHDVLEOHVROXWLRQVRLWPD\QRWEHHIILFLHQWLQJXLGLQJ$QWV

$OJR)3/6LQ)LJ)RUW 1WR12QO\RQHLWHUDWLRQLVH[HFXWHGLQWKHDOJRULWKP For t= 1..N

$OJR)3/6LQ)LJYLVLEO\SDUDPHWHUGHOWDLVFRPSXWHGLWLVQRWVHWDV\RXVD\ corrected in the algorithm and described in the algorithm description

:K\\RXXVHGPLQPD[DQW6\VWHPZK\QRW$QW4RU$&6because MMAS shows its effectiveness for many problems and is one of the most used versions in the literature

)LJ7KHILUVWOLQHLVUHSHDWHG line deleted

7KHHQYLURQPHQWRIVHDUFKRIDQWVLVQRWFOHDUO\H[SODLQHG

1RUPDOO\HDFKWLPHZHDGGDQREMHFWWRWKHSDUWLDOVROXWLRQWKHXSSHUERXQGPXVWEHXSGDWHG RWKHUZLVHLWZLOOQRWEHIHDVLEOHThe algorithm FPLS is executed separately at each iteration of ACO, we don’t calculate upper bound during the construction of solutions by ants.

,QILUVW\RXDVVRFLDWHSKHURPRQHWUDLOWRREMHFWVDQGWKHQ\RXVD\WKDWSKHURPRQHLVODLGRQ HGJHVDQGLQWKLVFDVHDQREMHFWFDQKDYHPDQ\SKHURPRQHYDOXHVQRWRQO\RQHYDOXH

Pheromone trails are associated to edges between each pair of selected items in the solution. S

(

o

j

)

k

τ

is the pheromone factor associated to the object Oj in the transition probability and is calculated as stated in equation 10.

,Q7DEOH2QHZHFRQFOXGHWKDWWKHHIIHFWRILQIRUPDWLRQKHXULVWLFVLVPRUHLPSRUWDQWWKDQWKHHIIHFW RIK\EULGL]DWLRQEHFDXVHWKHK\EULGDOJRULWKPIDLOVLQILQGLQJJRRGVROXWLRQVZKHQKHQRWXVHV+

We add a small paragraph before the conclusion to discuss this point. We modify the section 6. Conclusion

References

Related documents

This is likely tied to the relationship between Rental Assistance and on-farm/off-farm housing, since the majority of 514/516 projects located in the Western stream are

To emphasize the summative versus formative distinction, that is assessment of learning rather than for learning (Stiggins, 2006), theory and research on formative

The context of technology-related rehabilitation devices and services, has now adapted the assumptions and descriptions underlying the KTA model in the fol- lowing ways:

Findings: Here, we examine the levels of 5hmC and 5caC in 28 samples of normal breast tissue, 59 samples of invasive human breast cancer and 74 samples of gliomas

The purpose of this research is to discover how the interpretation of speech code for the graduate students of communication science Universitas Sumatera Utara whose originated

Time Series plot for Forcast using ar (2). Looking at Figs. 4, it shows that the P-values for the Ljung-Box statistics are not significant. The forecast as shown in Fig. 7 does

Our findings indicate that mothers’ income, fathers’ education and the time demands created by preschool children increase fathers’ share of gender-neutral leave as well as their

Then we apply the closure to the PARENT relation to obtain a BLOCK relation with perfect Recall in terms of name-matching (no matching names are split across blocks).. The