Peptide inhibitor
An Antiviral Peptide Inhibitor That Is Active against Picornavirus 2A Proteinases but Not Cellular Caspases
... To improve the properties of zVAD.fmk, it was necessary to replace the methylated aspartic acid residue with a hydropho- bic residue, which cannot be modified by demethylation and which in consequence cannot target ...
9
A cell penetrating ARF peptide inhibitor of FoxM1 in mouse hepatocellular carcinoma treatment
... Patients with HCCs have poor prog- noses because late detection and high frequency of tumor recurrence render current HCC therapy ineffec- tive (1). One of the potentially cura- tive approaches in HCC therapy is based on ...
14
A TAT-conjugated peptide inhibitor of polo-like kinase 1 for in vivo tumor imaging
... solid-phase peptide synthesis (SPPS) methods have been developed for the production of pep- tides with high yield and purity (Craik et ...using peptide drugs, such as cell permeability and access to ...
8
Retro inverso peptide inhibitor nanoparticles as potent inhibitors of aggregation of the Alzheimer’s Aβ peptide
... Amyloid-β peptide (Aβ) fibrils, and neurofibrillary tangles consisting of hyperphosphorylated Tau ...this peptide, with a potent ability to cause memory deficits and inhibition of oligomer formation is a ...
36
A synthetic peptide inhibitor for alpha chemokines inhibits the growth of melanoma cell lines
... MGSA/GROa is a 73 amino acid peptide which shares se- quence characteristics of a superfamily of peptides called a-chemokines. Richmond and colleagues initially discovered that melanoma cells secreted ...
8
PubMedCentral-PMC5628745.pdf
... permeable peptide inhibitor of MK2, MMI-0100, protects against fibrosis, apoptosis and systolic dysfunction in a mouse model of AMI induced by left-anterior descending coronary artery (LAD) ...
10
Mutations of Glu560 within HIV 1 Envelope Glycoprotein N terminal heptad repeat region contribute to resistance to peptide inhibitors of virus entry
... We found that resistance mutants containing L544S, G547D and E560G/D mutations in the selection of T20 in vitro (our unpublished paper). The susceptibility analy- sis of the mutants harboring the separated mutations sug- ...
11
Direct interaction with filamins modulates the stability and plasma membrane expression of CFTR
... FLNs are best appreciated as structural proteins that regulate cellular architecture. However, FLNs are now known to directly interact with membrane-spanning proteins including ion chan- nels, adhesion molecules, and G ...
12
Expanded Tropism and Altered Activation of a Retroviral Glycoprotein Resistant to an Entry Inhibitor Peptide
... (HIV-1) inhibitor enfuvirtide, which are derived from the C-terminal heptad repeat (HR2) of the transmembrane (TM) ...HR2-based peptide inhibitor of a model retrovirus, subgroup A of the Avian ...
7
Phage display derived inhibitor of the essential cell wall biosynthesis enzyme MurF
... first peptide inhibitor of the essential MurF amide ligase enzyme using a phage display ...12-mer peptide MurFp1 acted as a time- dependent inhibitor of MurF activity and its inhibitory ...
12
Kinetic Dependence of Paramyxovirus Entry Inhibition
... HRC peptide target ...thus, peptide inhibitors have different windows of time in which they may access the ...the peptide-accessible ...the peptide inhibitor affinity is unchanged, an ...
5
Clonorchis sinensis excretory/secretory products promote the secretion of TNF alpha in the mouse intrahepatic biliary epithelial cells via Toll like receptor 4
... inhibitory peptide (amino acid sequence: KYSFKLILAEY) or control peptide (amino acid sequence: RNTISGNIYSA) for 2 hours prior to stimula- tion as described ...TLR4 peptide inhibitor sets were ...
7
Gold nanoparticles-based electrochemical method for the detection of protein kinase with a peptide-like inhibitor as the bioreceptor
... this peptide inhibitor can induce the non-cross-linking aggregation of bare AuNPs through the electrostatic interaction (Scheme ...the peptide inhibitor bound with PKA, it lost the abil- ity ...
11
Hypertensive encephalopathy and the blood brain barrier: is δPKC a gatekeeper?
... Hypertensive encephalopathy is a life-threatening condition due to elevation of cerebral perfusion pressure beyond the limits of autoregulation. Breakdown of the blood-brain barrier (BBB) leads to cerebral edema and ...
5
Human Immunodeficiency Virus (HIV) gp41 Escape Mutants: Cross-Resistance to Peptide Inhibitors of HIV Fusion and Altered Receptor Activation of gp120
... N-peptide inhibitor N44* (GG VQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ) was ex- pressed in Escherichia coli and purified as previously reported ...five-helix inhibitor was kindly provided by Michael ...
8
Mechanism of HIV-1 Resistance to an Electronically Constrained α-Helical Peptide Membrane Fusion Inhibitor
... short-peptide inhibitor 2P23, which targets mainly the gp41 pocket site rather than the N43K-containing ...constrained peptide inhibitors, such as SC29EK and ...
17
Regulatory T cells in multiple sclerosis and myasthenia gravis
... antisense peptide; BPI: Bifunctional peptide inhibitor; CCL: Chemokine ligand; CCR: Chemokine receptor; CNS: Central nervous system; CSF: Central spinal fluid; CTLA-4: Cytotoxic ...
16
Amsacta moorei Entomopoxvirus Inhibitor of Apoptosis Suppresses Cell Death by Binding Grim and Hid
... The inhibitor of apoptosis (IAP) proteins are a distinct fam- ily of caspase inhibitors first identified in the baculoviruses Orgyia pseudotsugata nucleopolyhedrovirus (OpMNPV) and Cydia pomonella granulovirus ...
8
Cardiac resynchronization therapy improves heart failure in one patient with acromegaly induced cardiomyopathy: a case report
... On admission, magnetic resonance imaging showed pituitary macroadenoma. Given the symptoms described, we arranged blood testing of myocardial injury markers showing an elevated brain natriuretic peptide level of ...
6
Polymorphisms in Gag spacer peptide 1 confer varying levels of resistance to the HIV 1maturation inhibitor bevirimat
... Human immunodeficiency virus type 1 (HIV-1) infectiv- ity is dependent on virion maturation, a morphological rearrangement of the viral core that occurs concomitant with virus particle release [1,2]. HIV-1 maturation is ...
8