[PDF] Top 20 Functional Characterization of the Human Immunodeficiency Virus Type 1 Nef Acidic Domain

... four-glutamate Nef AC (6, 13) functions as a decisive structural element for Nef to bind PACS-1 in the manner of the furin AC, we considered the possibility that the structure of the Nef AC ... See full document

... deleted nef/LTR regions. Seventy HIV-1-infected LTS were recruited as part of a study on Australian long-term ...the nef/LTR re- gion using triple-nested PCR, 54 of the 59 participants with viral ... See full document

... full-length Nef protein from HIV-1 strain SF2 (MGGKWSKRSMGGWSAIRERMRRAEPRAE PAADGVGAVSRDLEKHGAITSSNTAATNADCAWLEA QEEEEVGFPVRPQVPLRPMTYKAALDISHFLKEKGGL EGLIWSQRRQEILDLWIYHTQGYFPDWQNYTPGPGIR ... See full document

... of Nef on HIV-1 infectivity, we made use of a previously described set of mutant HIV-1 pro- viruses that lack most or all of MA but are nevertheless able to replicate efficiently in MT4 T lymphoid ... See full document

... The human immunodeficiency virus type 1 (HIV-1) early gene nef is highly polymorphic (10, 25, 30, 38, ...the Nef gene product alters numerous pathways of T-cell ... See full document

... Fig. 1, 3, and 5A indicate that the function of Nef specifically requires leucine-mediated binding to AP ...HIV-1 Nef to stabilize the association of AP-1 and AP-3 on juxtanuclear ... See full document

... I domain to peripheral localization of Gag ...M domain is required for membrane localization of Gag, the I domain enhances the efficiency of membrane inter- action or acts to stabilize the ...I ... See full document

... 2 0022-538X/91/020583-06$02.00/0 Copyright © 1991, American Society for Microbiology Genetic Characterization of Human Immunodeficiency Virus Type nef Gene Products Translated In Vitro a[r] ... See full document

... A role for ADAM10 during nuclear trafficking is in concert with known cellular roles for this complex pro- tein. The protein has several known extracellular domains, which include a metalloprotease domain, an ... See full document

... Direct evidence for a role of a retroviral NC domain in the specific uptake of genomic viral RNA was recently provided by a study of the packaging specificity of a mutant of Rous sarcoma[r] ... See full document

... A Gag assembly element in the CA NTD. Studies from sev- eral laboratories indicate that the NTD of CA may not play an essential role in immature particle assembly (reviewed in ref- erence 41). Indeed, Gag proteins ... See full document

... HIV-1 nef can clearly substitute for SIVmac nef in this relevant animal model, we were not able to achieve moderate or high virus loads and disease progression in a workable time frame in 100% ... See full document

... HPB-ALL and HuT-78 human CD4+ T cells and the CD4+ human monocyte/macrophage line U937 transduced with LNefSN or the control vector LN were analyzed for CD4 and p56lck expression.. Figur[r] ... See full document

... of nef transgenic mice ...in Nef-expressing cells indicated that CD4 molecules accumulating in endosomes end up being ...in acidic early endosomes, which contain active proteolytic enzymes implicated ... See full document

... that Nef is a virion protein. Data presented herein indicate that Nef is indeed a virion ...virion-associated Nef acts in the recipient cell to increase the likelihood of successful ...of nef ... See full document

... While Nef is packaged nonspecifically and at relatively low levels compared to those of Vpr, its presence in HIV-1 virions may nevertheless be biologically ...that Nef associates with cellular ... See full document

... a functional form of Nef is important during the biogenesis of viral particles ...6. Characterization of a Nef-Vpr fusion protein containing a protease specific cleavage site between ... See full document

... HeLa CD4+ cells transfected with sense or antisense virus were cocultivated with MT4 cells, and virus production was monitored by reverse transcriptase assays of the supernatant medium..[r] ... See full document

... of Nef, however, is only manifested in the infected target ...that Nef enhances virion entry into the cytosol (64), perhaps reflecting changes in the lipid composition of the virion membrane ...stomatitis ... See full document

... 4037 Downloaded from http://jvi.asm.org/ on November 9, 2019 by guest We have expressed and purified from Escherichia coli a human immunodeficiency virus type 1 HIV-1 RNase H domain cons[r] ... See full document